SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022650 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022650
Domain Number 1 Region: 435-693
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.45e-72
Family Eukaryotic proteases 0.000000125
Further Details:      
 
Domain Number 2 Region: 28-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-30
Family Spermadhesin, CUB domain 0.00000222
Further Details:      
 
Domain Number 3 Region: 185-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-24
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 4 Region: 369-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000903
Family Complement control module/SCR domain 0.0000653
Further Details:      
 
Domain Number 5 Region: 315-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000737
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 138-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000806
Family EGF-type module 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022650   Gene: ENSMODG00000018167   Transcript: ENSMODT00000023048
Sequence length 699
Comment pep:novel chromosome:BROADO5:8:108535844:108550497:1 gene:ENSMODG00000018167 transcript:ENSMODT00000023048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSGPIRSTGIWCVVLFAVLAWAEETSMYGEILSPNYPQAYPNNVQKTWNITVPDGYG
IHLYFTHLDMELSANCEYDSVKVMSGGIVEGVLCGQKSSKNRNSPVVKEYQVPYSSLQVI
FESDFSNEERFTGFAAYYVAVDINECTDFIDPPCSHFCNNFIGGYFCSCPPEYFLYDDMK
NCGVNCSGNMFTDPTGEITSPNYPNLYPENSRCDYRISLEKGFQVVVTIKREDFDVEAGD
SGDCPDSLVFTARGQQFGPYCGNGFPGQQMIESRDNVLDIIFQTDQTGEKKGWKLRYYGD
PMPCPKEFTANSVQDPVKAKYVYKDTVKITCLEGFEVVEGRVSSTFFYSTCQNNGQWSKS
NLKCKPVDCGSPEPIKNGNVKDAENTLFGAVIQYTCNEPYYKMKNEGTGEYHCAANGTWV
NQELGMELPECVAVCGVPRLEFAGTQRIFGGVRADIGSFPWQVFFQNPRAGGALIDEHWV
LTAAHVVEGNDQPTMYMGTNEVRPSALKDAQMLLANGVFIHDGWASFGELDSRKNFDNDI
ALVRLKDPVKLGPNVSPICLPGRSPEYDPQFGTLGMISGWGKTERRFNAAFLQGAKLPVA
PLEKCRSVKNVDSRVDTSTFTFTDNMICAGGEKGSDSCEGDSGGAFAIQDPIEKNPKFYV
AGLVSWGPKCGTYGIYTKVKNYISWIEKTMQENRISDED
Download sequence
Identical sequences F7CCG9
ENSMODP00000022650 ENSMODP00000022650 XP_001370529.2.35504 XP_007503745.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]