SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022662 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022662
Domain Number 1 Region: 460-714
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-72
Family Eukaryotic proteases 0.000000073
Further Details:      
 
Domain Number 2 Region: 38-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-28
Family Spermadhesin, CUB domain 0.0000971
Further Details:      
 
Domain Number 3 Region: 210-322
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-27
Family Spermadhesin, CUB domain 0.0000381
Further Details:      
 
Domain Number 4 Region: 394-468
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 5 Region: 326-397
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000598
Family Complement control module/SCR domain 0.0000308
Further Details:      
 
Domain Number 6 Region: 157-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000038
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022662   Gene: ENSMODG00000018171   Transcript: ENSMODT00000023060
Sequence length 717
Comment pep:novel chromosome:BROADO5:8:108576219:108590376:-1 gene:ENSMODG00000018171 transcript:ENSMODT00000023060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLWGESRTPAQAQRMSLWHFLVSLLLCRLGDSIPIINKLYGEVTSPMYPKSYPNNYDE
TREIVVPQGYSVKLVFWQFDLEPSEGCFYDYVKISADKKDLGRFCGQLGSTPGNPPSQKE
FVSQGNQMWLTFHTDFSNEENGTTIFYKGFLAYFQAVDMDECAAQDNAIEENSNLGLRCE
HLCHNSVGSYFCSCRPGYKLQADKHSCRAECSNELFTETSGYISSLEYPQAYPPDMRCNY
SIRVDRGLTINLKFLEPFEIDDHQQVHCPYDQLQVYANGKSFGEYCGRKSPGVMDTSSNA
VDVLFFTDESGDSGGWKIHYTTEVIKCPQPKALDKFTVINNLQPQYQFRDYLIVTCKLGY
QLTEGNQQLKSFTSVCQDDGTWHRPMPYCKIVNCGAPKKLPNGNFKYLTKEGGNTYKAEI
LYTCQEPYYRMVNGEENAKYTCSAQGTWKDKHGNEKIPRCLPVCGKPVNPVVENQRIIAG
KSAQLGNFPWQAFTNIYGRGGGALLGDRWILTAAHILHPKDSSSLPNTSIDVFLGHTNVD
EIMKMGIRPVRRVIIHPGYNQNDTNNFDNDIALLELENSVPLGPHLLPICLPDNETFYEK
GLVGYVSGFGIESQKLSDDLKFVSLPMASSKNCQNWLNEKNSKQVFSTNMFCAGDKTRKQ
DACQGDSGGVFAVKDESGDRWVATGIVSWGIGCSKGYGFYTKVLKYVDWIKKEIGES
Download sequence
Identical sequences F7BU27
ENSMODP00000022662 XP_007503746.1.35504 ENSMODP00000022662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]