SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022770 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022770
Domain Number 1 Region: 23-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000152
Family Nucleotide and nucleoside kinases 0.051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022770
Domain Number - Region: 357-425
Classification Level Classification E-value
Superfamily Prefoldin 0.0811
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022770   Gene: ENSMODG00000018257   Transcript: ENSMODT00000023170
Sequence length 499
Comment pep:novel chromosome:BROADO5:4:415222153:415622470:-1 gene:ENSMODG00000018257 transcript:ENSMODT00000023170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLNQYDSSSISLETLFNSAGNTSNVPQTVVLQGVAGIGKSTLARKVLQGWAAGTLYPDRF
NYVFYIGCQEAHFLRESSMEQLITILCGDNNAPITDILKQPQKLLFVLDGLDELQFLSDE
QFYPSVNEKDSVNALWGSLIQKKLLPQSTLLITIRIPVLEKLEPWLKHSRHVKVLGFSQT
QKKEYFDLYFTNGDLGKKALDFVLKNKELSNECCAPLMCWIICSWMKQRQDQGKSPTKAL
KNRTDVYMAYISTFLTTEKSLSKSTQHVALRGLCFLAAEGIQSQKVLFTEGDLRRHSLDG
MDISSILNVSGAQAGLSGTMLYSFRHLSFQEFFNAMFYLLEEKSLLGKSQNVKELIQKQE
ASGTMQFLYGLLEKENEKNLELKFDLRISMPLRKEVETLKKKMDKVKNTIDTLQDFLYEK
KDFLVKVLFINNVSYKKAETQSFKSQSKRYPVKMNTSRLPREESKVKSIYSKTEGKGLKK
KTQRRTTQGKGRGFDQGPK
Download sequence
Identical sequences F6Q7Z2
13616.ENSMODP00000022770 ENSMODP00000022770 ENSMODP00000022770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]