SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022896 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022896
Domain Number 1 Region: 133-381
Classification Level Classification E-value
Superfamily vWA-like 2.3e-81
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 2 Region: 377-466
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-27
Family Integrin domains 0.00013
Further Details:      
 
Domain Number 3 Region: 633-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.37e-21
Family Integrin beta tail domain 0.00023
Further Details:      
 
Domain Number 4 Region: 26-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000513
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 5 Region: 591-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Integrin beta EGF-like domains 0.0011
Further Details:      
 
Domain Number 6 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 7 Region: 87-155
Classification Level Classification E-value
Superfamily Integrin domains 0.0000214
Family Integrin domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000022896
Domain Number - Region: 475-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 518-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022896   Gene: ENSMODG00000018360   Transcript: ENSMODT00000023301
Sequence length 800
Comment pep:novel chromosome:BROADO5:4:90570130:90769347:-1 gene:ENSMODG00000018360 transcript:ENSMODT00000023301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRLWSLSSCFLVFCTLLPQSPGLNICTSGSATSCEECLLINPKCAWCSKEDFGNQRSV
TSRCDLKANLLKLGCGGELESPDSSITVLKNLPLSIKGSSPSNADVIQMTPQKISMNLRP
GDKTPFRVQVRQVEDYPVDLYYLMDLSLSMKDDLDTILNLGTKLAEEMRKLTSNFRLGFG
SFVDKNISPFSYTAPRYQTNPCIGYKLFPYCVPSFGFRHLLSLTDKVDSFNEEVKKQMVS
RNKDAPEGGFDAILQAAVCKEKIGWRKEALHLLVFTSDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASKQMDYPSLALLGEKLAENNIHLIFAVTKNHYMLYKNFTALIPGTTVEIL
HADSRNIIQLIVNAYNSIRSKVELSVWDNPEDLGLSFTATCQDGLSYPGQRKCGDLKIGE
TVSFEVSVEARSCPSPDTVHTFTLRPVGFRDALELVVTYNCSCNCASRTEQDSPRCSGNG
TYTCGTCECHPSYLGSKCECQEGENRDLYQNLCREAEGKPLCSGRGECSCNQCSCYESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTETETCLSNDGQ
ICSGRGYCSCGRCQCIKPGAFGETCEKCPTCPDACSTKRDCVECMLFNSGRLADNQTCQK
HCRDEVIIQVDSIMKDDQEAVLCFYKTAKDCVMMFTYSELPSGKSKLMVLKEPECGSAPS
AMTILLAVVGSILLVGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIS
THTVDFTFNKLNKSYNGTVD
Download sequence
Identical sequences F6PPW0
ENSMODP00000022896 XP_007493880.1.35504 ENSMODP00000022896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]