SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022902 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000022902
Domain Number - Region: 252-287,398-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00507
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 251-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0155
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022902   Gene: ENSMODG00000018367   Transcript: ENSMODT00000023307
Sequence length 586
Comment pep:novel chromosome:BROADO5:4:90872329:90904627:-1 gene:ENSMODG00000018367 transcript:ENSMODT00000023307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTFFLLSCLLLFMASGNNQAKTNATTLVQNNVDTTLTTAPSPQTQTTSQTAPTPTPSAQ
TQTTSQTTATPTPSAQTQTTSQTTATPTPSAQTQTTSQTTATPTPSAQTQTTSQTTAKPT
PSAQTQTTSQTTATPTPSAQTQTTSQTTATPTPSAQTQTTSQTTATPTPSAQTQTTSQTT
ATPTPSAQTQTTSQTTATPTPSAQTQTTSQTTATPTPSAQTQTISQMTATPTTPSAQTQT
ISQTPAPTPESPCMKKNCGGDSSCIELNSEAYCQCSEGYYYNESMCYEGKTFLGTITVQT
ELSGLDDKKSQNYQNLYFSVQRFFEAAFSENNTYGQTIILDLQTFGTTRSVVRSRGQAAV
TVTNIFEKNSEVNEADVTKAIEEQLKINDTFLYETKNTCDLTGCLSDCTNGLQCPCQQDL
ARPASNPSSFCSVCSSTCNKESHQQCIKDPSALLPKCQCLPGYIRKGEGKCQECDFGYGG
VDCKDNYLLVLTVVCSVGGAILLGTIIALIVISSKKKKKSSEEDSLISSDSANMRMGTLG
FSNLGASNGSLFPKVTATQYGSNQSNGRSNPYEDHFSPRSVPARDY
Download sequence
Identical sequences F6RFV0
ENSMODP00000022902 ENSMODP00000022902 XP_007493881.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]