SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023082 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023082
Domain Number 1 Region: 130-318
Classification Level Classification E-value
Superfamily vWA-like 1.63e-60
Family Integrin A (or I) domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 1175-1378
Classification Level Classification E-value
Superfamily vWA-like 6.23e-57
Family Integrin A (or I) domain 0.00016
Further Details:      
 
Domain Number 3 Region: 430-617
Classification Level Classification E-value
Superfamily vWA-like 9.64e-57
Family Integrin A (or I) domain 0.00015
Further Details:      
 
Domain Number 4 Region: 2300-2505
Classification Level Classification E-value
Superfamily vWA-like 2.23e-56
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 2522-2725
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.32e-34
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 6 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 7 Region: 1757-1928
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 1941-2107
Classification Level Classification E-value
Superfamily Fibronectin type III 3.73e-22
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 9 Region: 1568-1729
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-21
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 1385-1472
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-20
Family Fibronectin type III 0.00042
Further Details:      
 
Domain Number 11 Region: 812-901
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-20
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 12 Region: 1001-1176
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 13 Region: 2120-2205
Classification Level Classification E-value
Superfamily Fibronectin type III 7.53e-19
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 14 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 2.8e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 15 Region: 909-993
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 16 Region: 1471-1563
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000794
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 17 Region: 2210-2293
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000123
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 18 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000171
Family Fibronectin type III 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023082   Gene: ENSMODG00000018507   Transcript: ENSMODT00000023494
Sequence length 3066
Comment pep:novel chromosome:BROADO5:2:327391750:327533413:-1 gene:ENSMODG00000018507 transcript:ENSMODT00000023494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIRLHSAFAAVCAAFLLSSIEAEVEPPSDLNFKIIDENTVHMSWAKPVDPIVGYRVTVD
PTTDGPTKEFTLSASNTETLLSDLIPEIEYVVTITSYDEVEESVPVIGQLTIQTGGPVDP
KEKKPGQTEIQKCSLSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDVGEGKTRVG
VVQYSSDTRTEFNLNQYYQRKDLLAAIKKIPYKGGNTMTGDAIDYLIKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELRQIASPPSLKHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIATDISSKYVKLSWDPSPSP
ITGYKVLLTPMIPGSKQQALSVGPQTTSLNVRDLSADTEYQISVYSMKGLTSSEPISIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTRVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVASKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPPETHVFTVE
DFDAFQRISFELTQSICLRIEQELKVIKKKSYVPPRNLNFSDETSYSFKVNWSPAGEHVF
TYHITYKEAPDGEAHTVVEPASSTSVVLDHLKPETLYLVNVTAEYEDGFSDPLTGEETTL
EVKGAPRNLKVTDETTDSFKIAWTQAPGKVLRYRIVYRSVPGGPRQEVTVPANERRKTLE
NLTPDTKYEVSVIPEYFSGPGSPLTGNAATEEVRGNPRDLRVSDPTTSSMKLSWSAAPGK
VKQYLVTYTPVAGGETREVTVKGETTSTQLKGLDQGTKYSLSVTALYASGAGDALSGEGT
TLEERGSARDLITKDITDTSIGAYWTSAPGMVRGYRVTWRSLYDDVETGEKNVPGDAIHT
VIENLQPETKYKISIFATYSSGEGNPLIGEATTDLSQKARTLRVDDETETTMRVTWQPAP
GKVVNYRVVYRPRGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKHRQGS
GTTLSKFKMPRNLKTSDSTMSSFRVTWEPAPGEVKGYKVTFHPTGDDQRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDGGESSPLIGQEMTTLSDTTVMPFLSKGMECFTRAEADI
VLLVDGSWSIGRANFKTIRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHKDRR
SLLDSVANLPYKGGNTLTGMALNFIRQNNFRPQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDDGVELFAIGIKNADESELKMIATDPDDTHAYNVADFDSLSRIVDDLTVNLCNSVK
GPGDLEAPSNLVISEVTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLETSTV
LKDLKPETEYVVNVYSVVEDENSEPLKGTETTLPVPVVSLNIFDVGPTNMRVQWQSIGGA
TGYLLSYKAVNATVPTTPKEMRVGSSVTDMQLVDLIPNTEYTVTVQAALYDLTSDPATAR
EVTLPLPRPRGLKLTDVTHSSMNVIWDPAPGKVRKYIVSYKTEEDDDVKQVEVDRSRTKT
SLGDLISQTLYTVNVVAVYDEGESPPVTAQETTRPVPAPINLRLTEVTPDSFRGTWDHGA
SDVSLYRVTWSPYGATEKMETILNGDENTLVFENLNPNTLYEVSVTAIYPDESESDDLTS
SERTLPEIPVTTLAPKSGPRNLQVYNATSKSLTVKWDPASGRVQKYRITYQPSTGDGPEQ
TTTIGGRQNSVVLQKLKPDTPYSITVSSLYSDGEGGRMTGRGKTKPLNTVKNLRVYDPST
STLNVRWDHAEGNPRQYKVFYAPTAGGLEEMVTTPGNTNYVILRNLQPDTLYTVTVVPVY
TEGDGGPTADTGKTLVRGLARNVQVYNPTPNTLDVRWEPAPGPVQQYRIVYSPQTGTRPS
ESITVPGNTRTVHLERLTPDTPYSVNIVAVYSDGEGNPSPSQGQTLPRGGPRNMKVFGET
TNSLSISWDHADGPVQHYRIIYSPTVGDPIDEYTTVPGRRNNAILQPLQTDTPYKITIVA
VYEDGDGGHLVGNGRTVGLLPPQNIHITDEWYTRFRVSWDPSPSPVLGYKIIYKPVGSNE
PMEVFVGEVTSYTLHNLNPSTTYDVNVYAQYDSGLSVPLTDQGTTLYLNVTDLTTYQVGW
NTFCVKWTAHRAATSYRLKLNPSDGTRGQEITVRGSETSHCFKDLSPDTDYGVTVFVQTP
NLEGPGVSVKEHTAVKPTEAPTEPPTPPPPPTIPPARDVCKGAKADIVFLTDASWSIGDD
NFNKVVKFIFNTVGAFDLISPAGIQVSFVQYSDEVKSEFKLNTYADKAQALGALQNIRYR
GGNTRTGKALTFIKEKVLTWESGMRKAVPKVLVVVTDGRSQDEVKKAALVIQQSGFSVFV
VGVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYT
SPGFKMLEAYNLTEKNFATVPGVSLESGSFPSYTAYRLQKNAFVNQPTVDLHPDGLPPSY
TIILLFRLLPESPSDPFAIWQITDRDYKPQVGVVADPSSKTLSFFNKDMRGEVQTVTFDT
DEVKSLFYGSFHKVHIVVTSKSVKLYIDCYEIIEKDIKEAGNITTDGYEILGKLIKGERK
SAAFQIQNFDIVCSPVWTSRDRCCDIPSRRDEAKCPAFPNACTCSQDSVGPPGPPGPAGG
PGAKGPRGERGINGAIGPPGPRGDSGPPGPQGPPGPQGPNGLSIPGEQGRQGVKGDTGEP
GLPGRSGSPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKP
GDHGRPGPSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMNRFNQMLNQIPNDYHSN
RNQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGLQGPPGDRGLPGEKGERGIGSQGPR
GLPGPPGPQGESRMGPPGSTGSRGPPGPPGRPGNSGIRGPIGPPGYCDSSQCASIPYNGQ
GYPGSG
Download sequence
Identical sequences F7AGY1
XP_007484268.1.35504 ENSMODP00000023082 ENSMODP00000023082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]