SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023102 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023102
Domain Number 1 Region: 260-553
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.23e-76
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000453
Further Details:      
 
Domain Number 2 Region: 39-291
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.45e-75
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023102   Gene: ENSMODG00000018526   Transcript: ENSMODT00000023514
Sequence length 553
Comment pep:novel chromosome:BROADO5:4:98096047:98147896:1 gene:ENSMODG00000018526 transcript:ENSMODT00000023514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALALRVATAAGTVRCALVSSNTAWTAQVRRYCSQPITVKERIERKRQEALLGGGQSRID
AQHKRGKLTARERISLLLDPGSFVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRING
RLVYVFSQDFTVFGGSLSGAHAQKICKVMDQAMMVGAPVIGLNDSGGARIQEGVESLAGY
ADIFLRNVMASGVVPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTN
EDVTQEELGGAKTHTTMSGVAHKAFENDVDALFNLREFFNYLPLSNQDPAPIRECHDLCD
RLVPELDTLVPAESTKAYDMVDIVHAVVDEREFFEIMPNYAKNIIIGFARMNGKTVGIVG
NQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLL
YAFAEATVPKITVITRKAYGGAYDVMSSKHLRGDVNYAWPTAEIAVMGAKSSRSASVLFS
GHSRFPELLLLSIPSFGSPFQLPLNDLFLRVPTGFVDDIIQPSSTRARICQDLDVLASKK
QASPWKKHANIPL
Download sequence
Identical sequences F7GL49
ENSMODP00000023102 13616.ENSMODP00000023102 ENSMODP00000023102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]