SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023109 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023109
Domain Number 1 Region: 33-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-41
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 481-593
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 3 Region: 271-335
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.028
Further Details:      
 
Domain Number 4 Region: 435-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000155
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 692-764
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000607
Family VWC domain 0.0099
Further Details:      
 
Domain Number 6 Region: 598-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000249
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023109
Domain Number - Region: 401-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00206
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 336-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.0555
Family Fibronectin type I module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023109   Gene: ENSMODG00000018531   Transcript: ENSMODT00000023521
Sequence length 820
Comment pep:novel chromosome:BROADO5:8:123547304:123678069:1 gene:ENSMODG00000018531 transcript:ENSMODT00000023521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHTMESPILGTTFCLIFYLRAVWGIGVDPSLKIDFLTALELGESTAGVLQVPGLHNGSKA
FLFQDTSRSVKASIATADQFFQKLRNKHEFTVLVTLKQIQLNSGVILSIHHLDKRYLELE
SSGHRNEVRLHYHSSSQQTQTEVFPYILADDKWHRLSLAISASHLILHVDCNKIYERVVE
RPSMDLPLGTTFWLGQRNDAHGYFKGIMQDVQLLVMPQGFITQCPDLNRTCPTCNDFHGL
VQKIMELQDILAKTSAKLSHAEQRMNKLDHCYCEKTCTMKGTTYQESESWTDGCKNCTCM
NGTIQCEALACSFPDCPSKSALAYVDGKCCKECKSICHFQGRTYFEGEKKPIYSSSGVCV
LYEMQDQTMKFVENAVCQPLNCPDSHHITLPHSCCKVCKGHDFCSVRHNCMENSICQNLN
DRAVCICQDGFRALREDNAYCEDIDECAEGQHYCQENTICVNIPGSFMCICKTGYLRIDD
YSCTEHDECITNQHNCDKNAICFNTVGGHNCVCNPGYIGNGTTCKAFCKDGCRNGGTCIA
SNVCACPSGFTGHSCETVDIDECSEGFVQCDNRANCINLPGWYHCECRDGYHDNGMFSPN
GESCEDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHNEKVKHSGQIWVLD
NDRCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDLRVTSQCLHQNGEILYNSGDTWV
QNCQQCRCLQGEVDCWPLPCPDLECEFSMVPENECCPLCVTDPCQADTIHNNIMKTCLDE
MHVIRFTGSSWIKHGTECTLCQCKNGHICCTVDLQCLQEL
Download sequence
Identical sequences F7GL36
ENSMODP00000023109 13616.ENSMODP00000023109 ENSMODP00000023109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]