SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023115 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023115
Domain Number 1 Region: 157-453
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-75
Family Protein kinases, catalytic subunit 0.0000603
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 3.47e-35
Family DEATH domain, DD 0.00000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023115   Gene: ENSMODG00000018536   Transcript: ENSMODT00000023528
Sequence length 458
Comment pep:novel chromosome:BROADO5:8:123945252:123970678:-1 gene:ENSMODG00000018536 transcript:ENSMODT00000023528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKTVTSSTYVRCLNVGLIRQLADFIDPQEGWKKLAVDIKKPSGENRYNQFHIRRFEGLL
QNGKSPTSELLFDWGTTNCTVGDLVDLLIRNDFLAPARLLLPDIIPEIVQVLPQEKLATQ
KKLLPPYDKEKTHVKPVQNHEHISSSLDSSPDRKSLEVSDTRFQSFSFYELKSVTNNFDE
RPMSAGGNKMGEGGFGVVYKGCINSRTVAVKKLTRMTDMCTEELKQQFDQEIKILAKCQH
ENLVQLLGFSSDSNDFCLVYVYMPNGSLLDRLSCLDGTEPLSWQTRCKIAQGTANGIYYL
HANNHVHRDIKSANILLDEDFLPKISDFGLARTSAKFNQTVMTSRIVGTTAYMAPEALRG
EITPKSDIYSFGVVLLEIITGLPAVDEQREPQLLLDIKEEIEDEEKHIEDYIDAKMNDVD
STSVENMYSIATLCLHEKKNKRPDTEMVKHHLQKMTSS
Download sequence
Identical sequences F7GD74
XP_001367252.1.35504 13616.ENSMODP00000023115 ENSMODP00000023115 ENSMODP00000023115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]