SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023184 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023184
Domain Number 1 Region: 69-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-27
Family Laminin G-like module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023184   Gene: ENSMODG00000018584   Transcript: ENSMODT00000023597
Sequence length 1132
Comment pep:novel chromosome:BROADO5:2:320670552:321103803:1 gene:ENSMODG00000018584 transcript:ENSMODT00000023597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDTACWILWLWMAFFLLPAATPMTVTAKSGSQASFLASNQKLLAELNLYIIFLIGFDLG
DSFSLRQVSCGGEKTCFKLGNALLIRDTQKIFPNGLPEEYSMAAIFRVRRSTKKERWFLW
QLLDHRNVPQVSIIIDGTKKVVEVMAFAAQGEMLHYVFKSREIFPLFDRQWHKLGLSIQS
RIISLYVDCNLVERRQTVEKDSVDFHGRTVIAARASDGKPVDVELHRLQVYCNPNFVAQE
MCCEISDAKCPQQDSFGTTVSLMATAHASKISAHLLAKPELAERCQCIPNKVREFQLREC
GEVTWKCIVMQGEAGLPGAAGLPGPRGEKGEQTFILCISFSLTQGEQGQKGDPGLGGTHG
KDGLKGDLGPPGPRGQKGEKGDMGPPGPPALIVSICKSQNTNLQNKQGSLGLEGPQGPPG
KEGQRVSKLTTSSKINPCYNYNKDNSGIFYFCLLELALEKGETGQPGFPGSVGPKGQKGE
MVSKIEQCGIKGEQGNIGFQGIKGEPGDPGLPGLLGNPGIKGQQGPAGSMGPRGPPGNIG
LPGEHGIPGKQGIKGEKGDPGGIIGPPGHPGPKGEAGPPGISLPGEPGLDGIPGTPGPRG
PKGERGLPGVHGLPGDTGPPGVGIPGQPGSRGPSGEPGIQGPRGLPGLPGTPGTDVSKGA
PGRDGKPGMPGPPGDPIALPLLGDIGAMLKNVCGSCHPSVPGLKVAKGEEGGAGEPGRHY
YAAGKGDTGSRGPPGIPGREGPKGSKGERGYPGLSGEKGDEGLQGIPGTPGAPGPIGPTG
PLGRTGHPGPAGAKGEKGNEGSPGKPGPPGPPGMPLSEGNGMSSLYKLQGSGSVATYPGP
PGPSGPKGDPGAVGEPGPMGLPGLEGFPGIKGDRGPAGSPGIAGIPGKSGAPGPPGLPGE
PGERGPVGDIGFPGPEGPEGKPGINGKDGSPGPQGPMGRPGDRGPKGERGDQGIPGDRGP
QGERGKPGLPGVKGIIGPMGPPGNKGSPGTPGYQGPPGSPGTPGIPADTVSFEEIKNYIN
QEVLRIFEERMAVFLSQMKLPAAMLSAQGHGKPGPPGKDGLPGPPGDPGPRGYRGQKGER
GEPGIGLPGNPGLPGPSATCMPGTPGAPGPQGPPGPSGRCSPDDCSHPVSHA
Download sequence
Identical sequences F7FD73
13616.ENSMODP00000023184 ENSMODP00000023184 ENSMODP00000023184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]