SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023213 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023213
Domain Number 1 Region: 236-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-23
Family Laminin G-like module 0.087
Further Details:      
 
Domain Number 2 Region: 59-175
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000138
Family Cadherin 0.0068
Further Details:      
 
Domain Number 3 Region: 14-71
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000542
Family Cadherin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023213   Gene: ENSMODG00000018610   Transcript: ENSMODT00000023626
Sequence length 872
Comment pep:novel chromosome:BROADO5:4:103734556:103983106:1 gene:ENSMODG00000018610 transcript:ENSMODT00000023626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFEAVVLNKTSGEGRLRAKSPIDCELQKEYTFIIQAYDCGAGPHETNWKKSHKAVVHIQ
VKDVNEFAPTFKETMYKAVVTEGKIYDSILQVEAIDEDCSPQYSQICNYEIVTSDVPFAI
DRNGNIRNTEKLSYDRQHQYEIMVTAFDCGQKHATESVLVQVDVKPVCKPGWQDWAKRIE
YKPGSGSMPLFPSIHLETCDGPVSSIQITTELQTNYIGKGCDRETYSEKSLQKLCGASSG
AIDLLPSPSAATNWTAGLLVDNNDMIFKFDGKQGAKIPDGIVPKNLTDQFTITMWMKHGP
SPGVRAEKETILCNSDKTEMNRHHYALYVHNCRLVFLLRKDFDQADTFRPAEFHWKLDQI
CDKEWHYYVVNVEFPVVTLYMDGTTYEPYLVTNDWPIHPSHIAMQLTVGACWQGGEVTKP
RFAQYFHGSLASLTIRPGRIESQKVISCLQACKEGLDINSLESLGQGIKYHFNPPQSVLV
MEGEDIGNINQALQKVSYINSRQFPTAGVRRLKVSSKVQCFGEDVCISIPDVDAYVMVLQ
AIEPRITISGTDHLVRPAAQFESTRGVTLFPDVKIVSTFAKAEPPEDSNEEDQAPKHVLL
EEMLHNLDFCDILVTGEELEPGQECLELDYDELRERHLDATNSTSGYSIYGVGTMTSYEQ
VLRQVRYRNWQPASLDDRKFQIKCSELNGRYTSNEFNLEVNVLHEMNSDTVHINHMIVQP
QFLQSIHHSEPEISSMRNSVIPSIATVVIIVCVGMLVFVVAMGVYRIRAAHQHCIQENES
TKESEMDWDDSALTITVNPMEKYEEPGHVEEESEEEEEEEEEVEEEESSSDDSDDSEEEE
EEIGKGRAEETKDQRIVTQLDEELRFKRGSEE
Download sequence
Identical sequences F7BPR7
ENSMODP00000023213 ENSMODP00000023213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]