SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023226 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023226
Domain Number 1 Region: 33-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-68
Family SPRY domain 0.00000000834
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000889
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023226   Gene: ENSMODG00000018624   Transcript: ENSMODT00000023640
Sequence length 273
Comment pep:novel chromosome:BROADO5:4:104562052:104698862:1 gene:ENSMODG00000018624 transcript:ENSMODT00000023640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGSIKSVDVREPPYQSVKRDLRGPDFCRPARLDLLLDMPPARTEVQHQHAWNPED
RSLNIFVKEDDRLTFHRHPVAQSTDCIRGKVGHARGLHVWQIHWPTRQRGTHAVVGVATA
EAPLHSVGYTALVGSNSESWGWDLGRNRLYHNCKNQPGVTYPAFLEPDEAFVLPDSLLVV
LDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEITMRYINGLDPEPLPLMDL
CRRSIRFALSRERLHEIESLPLPQSLKNYLQYQ
Download sequence
Identical sequences F7B312
ENSMODP00000023226 ENSMODP00000023226 XP_001365796.1.35504 13616.ENSMODP00000023226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]