SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023242 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023242
Domain Number 1 Region: 61-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000613
Family PAPS sulfotransferase 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023242
Domain Number - Region: 325-368
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023242   Gene: ENSMODG00000018639   Transcript: ENSMODT00000023656
Sequence length 407
Comment pep:novel chromosome:BROADO5:4:109325989:109628682:1 gene:ENSMODG00000018639 transcript:ENSMODT00000023656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRAGRTMVERTSKFLLIVAGSVCFMLILYQYVGPGLSLGAPSGRALADDLDLFPTPDPHY
VKKYYFPVRELERALTFDMKGDDVIVFLHIQKTGGTTFGRHLVQNVRLEVPCDCRPGQKK
CTCYRPNRRETWLFSRFSTGWSCGLHADWTELTNCVPGVSPLGSSFSAFPSRKFYYITLL
RDPVSRYLSEWRHVQRGATWKTSLHMCDGRTPTPEELPPCYEGTDWSGCTLQEFMDCPYN
LANNRQVRMLADLSLVGCYNMSFIPENKRAQVLLESAKKNLRDMAFFGLTEFQRKTQYLF
ERTFNLKFIRPFMQYNSTRAGGVEADSDTIRRIEELNDLDVQLYDYAKDLFQQRYQYKRQ
LERMEQRIKNREERLLHRSSEALPKEEAEEQGRLPTEDYMSHIIEKW
Download sequence
Identical sequences F7B299
ENSMODP00000023242 13616.ENSMODP00000023242 ENSMODP00000023242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]