SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023296 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023296
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000292
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 15-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000155
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 3 Region: 52-94
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023296   Gene: ENSMODG00000018687   Transcript: ENSMODT00000023711
Sequence length 157
Comment pep:novel chromosome:BROADO5:2:314010207:314023250:-1 gene:ENSMODG00000018687 transcript:ENSMODT00000023711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLSVFNSGTKCEVNINECLSEPCLNDGICADGISYYTCYCKDGFIGTHCETNADACLSD
PCLHGRCIDFIDGYECSCEAGWTSSRCEININDCASAHCINGGSCKDLVNGFVCVCPSGF
TGKSCEEDIDVCEDPAMNLAYCLNEGICVDGPGHNFS
Download sequence
Identical sequences F7AED6
ENSMODP00000023296 13616.ENSMODP00000023296 ENSMODP00000023296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]