SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023309 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023309
Domain Number 1 Region: 191-373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.6e-29
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.41e-21
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 132-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000534
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023309   Gene: ENSMODG00000018697   Transcript: ENSMODT00000023725
Sequence length 394
Comment pep:novel chromosome:BROADO5:2:312522955:312524139:-1 gene:ENSMODG00000018697 transcript:ENSMODT00000023725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFLCLSLTRGSVQLRYNLGDRTVILQSLQKIHTGRGFWHTIKAGRVGNEGYLELDGINVT
KGATAGMRALDTSTDFYIGGVSSLSLVNPMAIENEPVGFNGCVREILINGRELKLTEAGA
KRGSNVGDCDGTPCGYKVCENKGQCRAQGSKFSCKCLQPWIGKRCEESANCRNNLCLHHS
RCIPVQPAAYICLCPLGWVGRYCDNETSFITAKFVGNSYIKYTDPNYEKRDLRFTAVSLN
FSTTITEGLILWMGKAEHEENDFLAIGVHNRTLKVMVNLGERISVPLLNSSAFLYYKQWH
HVKVVQNQTYFKVYLDGDLILFEDIDPTKNYIALNYGGVSYLGGFEFGRGVNMVTQGLFN
RDFIGKIKDVVFFQDQKKIELIKSEGYNIYNGDE
Download sequence
Identical sequences F7FQP2
13616.ENSMODP00000023309 ENSMODP00000023309 ENSMODP00000023309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]