SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023310 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023310
Domain Number 1 Region: 3-415
Classification Level Classification E-value
Superfamily Cytochrome P450 5.89e-86
Family Cytochrome P450 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023310   Gene: ENSMODG00000018698   Transcript: ENSMODT00000023726
Sequence length 416
Comment pep:novel chromosome:BROADO5:4:110919408:110942494:1 gene:ENSMODG00000018698 transcript:ENSMODT00000023726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAQVLRAEGITPQRANMESWQEYRDLRGRSTGLISAEGEQWLKMRSVLRQRILKPKDVA
IFSGEVNQVIADLIKRIYVLRNQEADGETVTNVNNLFFKYSMEGVATILYECRLGCLENN
VPQLTMEYIEALELMFSMFKTTMYAGAIPKWLRPFIPKPWKEFCRSWDGLFKFSQIHVDN
KLKDIQSQLDRGESLRGGLLTHLLISKELTLEEIYANMTEMLLAGVDTTSFTLSWAAYLL
AKHPEVQQSVYHEIIKNLGKKHIPTAEDIPKVPLIRALLKETLRLFPVLPGNGRVTQEDL
IIGGYLIPKGTQLALCHYATSYEEENFPMAKEFKPERWLRKGNMDRVDNFGSIPFGYGLR
SCIGRRIAELEIHLVMIQLLQHFEIKTSPLTKTVHAKTHGLLTPGESINVRFVTRK
Download sequence
Identical sequences F7FQJ8
XP_007494060.1.35504 XP_007494061.1.35504 XP_007494062.1.35504 XP_016289054.1.35504 ENSMODP00000023310 ENSMODP00000023310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]