SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023416 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023416
Domain Number 1 Region: 31-217
Classification Level Classification E-value
Superfamily vWA-like 2.37e-56
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 230-421
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-27
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023416   Gene: ENSMODG00000018777   Transcript: ENSMODT00000023832
Sequence length 957
Comment pep:novel chromosome:BROADO5:2:306154560:306299441:-1 gene:ENSMODG00000018777 transcript:ENSMODT00000023832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQHTKYLQVILILLLQDFASAEDGEIRSSCRTAPTDLVFILDGSYSVGPENFEIVKKWL
VNISNNFDIGPKFIQVGVVQYSDYPVLEIPLGSHHSGENLMEAMESIQYLGGNTRTGKAI
QFALDHLFAKSSRFLTKIAVVLTDGKSQDEVKDAAEAARDNRITLFAIGVGSETEDAELR
AIANKPSSTYVFYVEDYIAISKIREVIKQKLCEESVCPTRIPVAARDEKGFDILLGLGVK
KKVKKRIQLSPTKTKAYEVTSQVDLSELTSNVFPEGLPPSYVYVSTQRFKVKKKWDLWRI
VTSDGRPQIAVTLNGAEKTLSFTTTSIMNGTQVVVFAEPDVKTLFDEGWHQIRLLVTEQD
VTLYIDDQQIKSKSLHPVLGIYVSGQTQIGKYSGKEETVQFDVQKLRIYCDPEQNNRETA
CEIPGFNGECLNGPSDVGSTPAPCVCPPGKPGLQGPKGDPGQPGNHGYPGQPGQDGKPGY
QGISGSPGIPGSPGIQGARGLPGYKGEPGRAGIKGDRGVPGFPGQHGMPGSKGEMGPRGE
KGSPGFYGKKGAKGEKGNTGFPGLPGHSGEPGRDGKDGLIGIPGFKGDTGQQGAPGPEGQ
RGEPGIPGFPGSRGLIGQKGEIGPPGPQGKKGAPGLNGLMGVEGSPGQPGTPGLKGNKGE
PGNQGITGPPGIKGEQGISGSPGDPGYPGLPGTPGKKGDSGNQGEKGLQGPKGENGRSGD
PGQQGIPGQHGAKGEKGEKGDPGSRGASGPKGESGMDGLIGPIGPRGQHGETGPRGPPGL
DGKPGREFSEQFIRQVCTDVLRAQLPVLLHSGRLQNCDHCQSQNGSPGLPGPPGPMGPEG
PRGFPGLPGRDGVPGLMGTPGHPGARGIKGQPGRNGAKGNDGFGHPGEQGPPGPPGPEGP
PGISKEGHPGEPGLPGKDGDPGNPGIQGPTGPPGICDPSLCFSVIVGRDPFRKGPNY
Download sequence
Identical sequences F7ADL7
XP_001371684.1.35504 ENSMODP00000023416 ENSMODP00000023416 13616.ENSMODP00000023416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]