SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023519 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023519
Domain Number 1 Region: 36-495
Classification Level Classification E-value
Superfamily Cytochrome P450 7.86e-130
Family Cytochrome P450 0.00000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023519   Gene: ENSMODG00000018850   Transcript: ENSMODT00000023935
Sequence length 497
Comment pep:novel chromosome:BROADO5:2:296416059:296449417:-1 gene:ENSMODG00000018850 transcript:ENSMODT00000023935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLDLLSILSGLSLILILILNMKLTLTKNFKKQSPPGPKPLPVIGNLHILNLKRPYQTM
LELSKKYGPIFSLRMGPKTVVVLSGYETVKDALVNYSEQFGERARIPIFERIFEGKGIVF
SHGENWKITRRFSLTTLRNFGMGKRVIEERILEECHHLIQVFESHQGELPFEISTIMSAS
VANIIVSILFGKRFDYKDPQFLRLLHLIGENIRLAGGPSITIFNMFPVLGFLLQDLKRVL
RNRDELFSFIRTTFLKHLRKLDKNDQRSFIDAFLIKQQEEKDKSDDYFNNDNLVALVSNL
FAAGTETTSSTLRWGILLMMKYPEIQKKVHNEITEVIGSAQPRIEHRTQMPYTDAVIHEI
QRFSNILPMNLSRETTTDVIFKNYYIPKGTEVITLLTSVLQDQTQWEKPCTFHPQHFLTK
EGKFIKRDAFLPFSAGQRMCAGESLAKMELFLFFTSLLQKFTFCPSPGVSNSDLDLTPDI
GFTTRPQPYKICALPYF
Download sequence
Identical sequences F7DWE4
ENSMODP00000023519 ENSMODP00000023519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]