SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023555 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000023555
Domain Number - Region: 376-470
Classification Level Classification E-value
Superfamily Tropomyosin 0.000163
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 675-777
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000837
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number - Region: 9-62
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023555   Gene: ENSMODG00000018879   Transcript: ENSMODT00000023973
Sequence length 886
Comment pep:novel chromosome:BROADO5:2:496796605:496808146:1 gene:ENSMODG00000018879 transcript:ENSMODT00000023973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLESEASVKRKVSLVLEQMQALMQGSPSSVSQAMAVHRGLIQKIEELQQKLDEEMKKRQK
LELTHEPSRLVLERQLEEKVEECMRLQEKLEKKKAEMQRSTQEFQDMKLLLDQGERLRHG
LEDQLKEMQDRLRQGQNPDAAKETLLKDLLETRELLEEVLEGKQRQEEQLRQRERELTAL
KGVLKEEVSSRDQEVERVRQQCQQDMEQLRQSVKDASQDQATLEAERQKVSTLIRGLQRE
LQESAEETGHWQGMFQKNKEELRGTKQELLQLRLEKEDLEEELREQIGVLQKDLEQARTS
AEDNRQAESLKKELKRAQEELQDLREQQSQEAAGKNRERELEKELEALKEEAKRGKGAEQ
QQLQLHKSLQQLRQDYEETAKARARRLEERGSEVTMMGQRRAAVEATLRETQEENDEFRR
RILGLEQQLKEARSLAEGGEAVEARLRDKVQRLEAERQRLEKALNASQEEEESLAGAKRM
LEGQLEEAQRNLIRFGQEQKILNRALEEEGKQREVLRRNKAELEDQKRLLDKTVEKLNKE
MEKIGEESQRALGELQAQLEEYKEKARRDVAGAQRQAKEWASEAEKAAGGLGQLQEEAQR
LRQALQALQAERDTALLDKDLLAQKLQGLEKETESKKRSQDDKIRQLKNLEEKVSRLEAE
LDEERNTVELLTDRVNRARDQIDQLRAELLQERSSRQDLECDKISLERQNKDLKSRLASL
EGFQKPSASLSQLEFQNQELQDRLQTEEREKTLLQTTNRKLERRVKELSIQIDDERQHVN
DQKDQLSLRVKALKRQVDEAEEEIERLDSLRKKAQRELEEQHEVNEQLQARIKTLEKDSR
RKATRSAAEASLKHDGLSSDEEFDSIYDPSSIASLLTESNLQTSSC
Download sequence
Identical sequences F7DA68
ENSMODP00000023555 13616.ENSMODP00000023555 ENSMODP00000023555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]