SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023560 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023560
Domain Number 1 Region: 32-218
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.44e-49
Family Astacin 0.00022
Further Details:      
 
Domain Number 2 Region: 388-556
Classification Level Classification E-value
Superfamily TRAF domain-like 3.43e-36
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 227-391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.4e-27
Family MAM domain 0.01
Further Details:      
 
Domain Number 4 Region: 633-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023560   Gene: ENSMODG00000018884   Transcript: ENSMODT00000023978
Sequence length 707
Comment pep:novel chromosome:BROADO5:2:292804813:292839679:1 gene:ENSMODG00000018884 transcript:ENSMODT00000023978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSNLFPDAGLVLFEGDILLENKTRNALRDPTTRWKFPIPYILADNLGLNAKGVILYAFEM
FRLKSCVDFKPYNGEETYIIFQEFDGCWSEVGDKHTGQNLSIGSGCDYKAIVEHEILHAL
GFYHEQSRSDRDDYVNIWWDEIIPGYEHNFNTYNDSYITDLNTPYDYESLMHYEPFSFNK
NASAPTITAKIPAFDDIIGQRLDFSTVDIERLNRMYNCTATHTLLDQCSFEKQNICGMIQ
GTRDDEDWIHKRGDSPGQEDHTLVGKCKEAGYFMYFNTSSGMKEEAALLESRILYPKRKQ
QCLQFYYKMTGSPSDRLVVWVKRDDSTGNVRKLVKIQTFHDDDNDHGWKIGQVTLREEVK
FRYLFQGSKGDPQNSAGGIFLDDITLTETPCPRGVWMVRNFSQVLQDTPKGQGLDSPRFY
SLEGYGYGVTLYPNGRYTSTVSGYVGLTFHLFSGENDAILEWPVENRQAIMTMVDNDPDV
KKRMSSSMVFTTSKNHLSSALNNSIWDRPSIVGTYDRTCECYRSIDWGWSTVISHQQLQK
RNFIKDDTLVIFVDFEDITYLNRTEVPVPSVRQRPSGLILQNPEHYTPQEDSKTMPLEET
QPGSLDARPGRQKRSVENTGPLEDHNWPQYFRDPCEPNPCQNEGICVNVKGMASCRCASS
HAFYYTGERCQAMQVHGSILGMMIGGIAGTIVLTIAIISIMSKRLTP
Download sequence
Identical sequences F7CRA2
ENSMODP00000023560 ENSMODP00000023560 13616.ENSMODP00000023560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]