SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023672 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023672
Domain Number 1 Region: 353-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 2 Region: 312-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000745
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 275-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 236-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000312
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023672
Domain Number - Region: 205-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00778
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023672   Gene: ENSMODG00000018972   Transcript: ENSMODT00000024092
Sequence length 526
Comment pep:novel chromosome:BROADO5:2:287695867:287700807:-1 gene:ENSMODG00000018972 transcript:ENSMODT00000024092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMCCLDWGRGAGGSEHSGEGGGPAGGQAGGGPGGGRVLPAHAAPGKRPERTKLPPPPPL
LGLARIRRFPERSAWMRLPWPAPWPYRGPPCAAPGSGPDPVGSPGPARRAPLPQLAGILG
ALRRHPRGVRLRPSLLGPALTMPSGCRCLQLVSLLWILGASGQPTHADDCSSHCDLAHGC
CEPDGTCRCDPGWEGLHCEQCVRMPGCQHGTCHQPWQCICSNGWAGKFCDKDEHICTKQP
PCQNGGKCVYEGDGEYHCVCPPGFHGHNCERKTGPCEHAGSPCRNGGQCQDDQGFAENFT
CRCLAGFVGPRCEVNVDDCLMRPCANGATCHDGINRFSCHCPKGFAGRFCTVNLDDCASR
PCQHGARCRDRVHDFDCLCPDGFGGKTCEIVLPALDLPTEPDSAPGPTPAAVVPFTVPAP
FSVGAGLLRISVKEVVRRQEAGIGDSSLIVLFIFGAITITGVFGTGLVIFWVRRHGHCPT
GPCCCPYHQYAPPPERHDQECQVSMLPAGISPPPDFPSELGKTTAL
Download sequence
Identical sequences F7FPK7
ENSMODP00000023672 ENSMODP00000023672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]