SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023728 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023728
Domain Number 1 Region: 1562-1820
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-56
Family YWTD domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 424-684
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-45
Family YWTD domain 0.0000121
Further Details:      
 
Domain Number 3 Region: 116-374
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-43
Family YWTD domain 0.0000219
Further Details:      
 
Domain Number 4 Region: 2406-2671
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-41
Family YWTD domain 0.00000716
Further Details:      
 
Domain Number 5 Region: 763-1003
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-34
Family YWTD domain 0.0000337
Further Details:      
 
Domain Number 6 Region: 1451-1554,1813-1874
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-22
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 2102-2142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000746
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 8 Region: 2144-2180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 9 Region: 2186-2231
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 2020-2060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 1227-1264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1902-1942
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 14 Region: 2064-2103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 15 Region: 1349-1383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 16 Region: 1981-2018
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 17 Region: 1267-1302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1134-1173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 1944-1982
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 1386-1426
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 21 Region: 1865-1900
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 2277-2310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 23 Region: 1307-1341
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 24 Region: 1058-1095
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 4-66
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000732
Family YWTD domain 0.0022
Further Details:      
 
Domain Number 26 Region: 377-419,690-726,1004-1058
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 27 Region: 1191-1223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 2318-2396
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 29 Region: 2228-2264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 30 Region: 77-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000744
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023728   Gene: ENSMODG00000018968   Transcript: ENSMODT00000024151
Sequence length 2987
Comment pep:novel chromosome:BROADO5:Un:36287107:36346042:1 gene:ENSMODG00000018968 transcript:ENSMODT00000024151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNTLAKANKWTGHNVTVVQRTNTQPFDLQVY
HPSRQPMAPNPCEANGGRGPCSHLCLINYNRTVSCACPHLMKLDKDKTTCYEFKKFLLYA
RQMEIRGVDLDAPYYNYIISFTVPDIDNVTVLDYDAREQRVYWSDVRTQAIKRAFINGTG
VETVVSADLPNAHGLAVDWVSRNLFWTSYDTNKKQINVARLDGSFKNAVVQGLEQPHGLV
VHPLRGKLYWTDGDNISMASLDGSNRSLLFTGQKGPVGLAIDFPENKLYWISSGNHTINR
CNLDGSGLEIIDTMRSQLGKATALAIMGDKLWWADQVSEKMGTCNKADGSGAVVLRNSTT
LVMHMKVYDESIQLGLQGNNPCSVNNGDCSQLCLPTSETTRSCMCTAGYSLRSGQQACEG
VGSFLLYSVHEGIRGIPLDPSDKSDALVPVSGTSLAVGIDFHADNDTIYWVDMGLSTISR
AKRDQTWREDVVTNGIGRVEGIAVDWIAGNIYWTDQGFDVIEVARLNGSFRYVVISQGLD
KPRAITVYPEKGYLFWTEWGQYPRIERSRLDGTERVVLVNVSISWPNGISVDYEEGKLYW
CDARTDKIERIDLETGENREVVLSSNNMDMFSVSVFEDFIYWSDRTHANGSIKRGSKDNA
TDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCAVANGGCQQLCLYRGGGRWTCACAHGMLA
EDGASCREYAGYLLYSERTILKSVHLSDERNLNAPVQPFEDPEHMKNVIALAFDYRAASS
PGTANRIFFSDIHFGNIQQINDDGSGRVTIVENVGSVEGLAYHRGWDTLYWTSYTTSTIT
RHTVDQSRPGAFERETVITMSGDDHPRAFVLDECQNLMFWTNWNEQHPSIMRAALSGANV
LTLIERDIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVILKSEPVHPFGLAVY
GEHIFWTDWVRRAVQRANKYVGSDMKLLRVDIPQQPMGIVAVANDTNSCECELSPCRINN
GGCQDLCMLTPQGHVNCSCRGARILQDDFTCRAVNSTCRAQDEFECANGKCISFSLTCDG
ISHCKDKSDEKPSYCNTRRCKKTFRLCNNGRCVPNSLWCNGADDCGDGSDEIPCNKTACA
ANEFQCQDGGCISNSSRCNQFLDCEDASDEMNCSTTDCSSYFRLGVKEVTFHPCERTSLC
YASSWVCDGANDCGDYSDERDCPGMKRPRCPLNYFPCPSGRCIPMSWTCDKEDDCEHGED
EVHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSDEAEHCQGKTCGPSSFSCPGTHI
CVPDRWLCDGDKDCADGADESVAAGCLYNSTCDEREFMCQNRQCIPKHFVCDHDRDCADG
SDESLECEYPTCGPTEFRCANGRCLSSRQWECDGENDCHDQSDEAPKNPHCTSPEHKCNA
SSQFLCESGRCVSESLVCNGQDDCGDSSDERSCHINECLSRKLSGCSQDCEDLKIGYKCR
CRPGFRLKDDGRTCADVDECSTSFPCSQRCINTHGSYKCLCVEGYAPGGDPHSCKAVTDE
EPFLIFANRYYLRKLNLDGTNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMN
INGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREP
RALVVDVQNGYLYWTDWGDHSLIGRIGMDGSGRSVVVDTKITWPNGLTLDYVTERIYWAD
AREDYIEFASLDGSNRHIVLSQDIPHIFALTLFEDFVYWTDWETKSINRAHKTTGANKTL
LISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGGDG
RTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICT
NPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERD
CPEVTCAPNQFQCAITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRC
IPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDE
ESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIP
LRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENP
EECARFQCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQSPHCKDKKAQ
FLCRNGRCLSATLRCNMFDDCEDGSDEEGCSPDPKLSSCAGNGSVCGDEARCVQSPKAVY
CACRPGFHTVPGQRGCQDINECLRFGTCSQLCNNTKGSHLCSCARNFMKVHNTCKAEGSE
YQVLYIADDNEIRSLFPGHPNSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISF
RSLPPTAPPTTSNRHRRQTEGGVTHLNISGLKMPRGIAIDWVAGNIYWTDSGRDVIEVAQ
MKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQW
PTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPVLAADSKRGLSHPFSIDVFEDYIYGVT
YINNRVFKIHKFGHSPLINLTGGLSHDSDVVSISDVNLYSYIKMSILFCLFLITETFICP
QGVCRHTFFYYVSKILGLLQTECVAWAQKGSGQWAFMLSTSLHSIGEGTMKLLEKCFDYC
ENQGVCQMASDGTKLCRCTGQFEGPQCQVDKCSRCLDGTCTILRQSGDVSCNCSDGRVAP
SCLTCDGHCFNGGSCTMNSKQMPECQCLSPNTGPRCEQSASESQPGRIASILIPIFLLLL
LLLVAGTVFWYKRRVRGAFQHQRMTNAMNVEIGNPTYKMYEGGEPDDWGLLDADFALDPD
KPTNFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGLEDELGDPLA
Download sequence
Identical sequences H9H785
ENSMODP00000023728 ENSMODP00000023728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]