SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023958 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023958
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000503
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023958   Gene: ENSMODG00000019191   Transcript: ENSMODT00000024382
Sequence length 152
Comment pep:novel chromosome:BROADO5:5:21642603:21653442:1 gene:ENSMODG00000019191 transcript:ENSMODT00000024382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGIPWYILLNAMVSLSKEAAVPVSTPITSQPSNWTVNKTEAEYTEGPIALKFSHTCLA
DHHSYCINGICVFHHELKKATCRCTTGYTGERCEHLTLNSYAVDSYEKYIAVGIGVGLLL
SLFLAIIYCYIKKRYMKLKPPYKVCSGERRPL
Download sequence
Identical sequences F7A9H6
XP_007495735.1.35504 ENSMODP00000023958 ENSMODP00000023958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]