SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024012 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024012
Domain Number 1 Region: 446-747
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.84e-72
Family Protein kinases, catalytic subunit 0.000000447
Further Details:      
 
Domain Number 2 Region: 307-403
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 3 Region: 69-157
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-21
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024012
Domain Number - Region: 174-263
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0157
Family Frizzled cysteine-rich domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024012   Gene: ENSMODG00000019238   Transcript: ENSMODT00000024439
Sequence length 943
Comment pep:novel chromosome:BROADO5:3:492927:675060:1 gene:ENSMODG00000019238 transcript:ENSMODT00000024439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALELFPQLAALGAAAFLVAFPPLLRMPGAAGAMEVPHTNEPLGQLDGPDSPLPTPTG
YFLNFLEPVNNITIVQGQTAILYCKVAGNPSPNIRWLKNDAPVVQEPRRIIIRKTDYGSR
LRIQDLDTTDTGYYQCVATNGVKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRG
IACARFIGNRTIFVDSLQMQGEMENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLC
DEWSRTPKRRELCRDECEVLENDLCRQEYNIARSNPLILMQFQLPKCEDLPLPESIEAAN
CMRIGIPVERLNRYHQCYNGSGSDYRGTVSSTQSGHPCQAWSAQSPHSHPLSSVDFPEIA
GGHAYCRNPGGQMEAPWCFTRNQNVRMELCDIPSCSPQDSSKMGILYILVPSIAIPLVIA
CLFFLVCMCRNKQKASGATPQRRQLMASPSQDMEMPLINQHKQAKLKEINLSSIRFMEEL
GEDRFGKVYKGHLFGTTPGEQTQIIAIKTLKDKAEVPLREEFKHEAMMRSRLQHPNIVCL
LGIMTKEHPVSMIFGYCSHSDLHEFLVMRSPHSDVGSTDDEKTVKSTLEPADFFHIVVQV
AAGMEYLSSHHVVHKDLATRNILVFDKLSVKISDLGLFREVYSADYYKLIGNSPLPIRWM
SPEAIMYGKFSIDSDIWSYGVVLWEIFSYGLQPYCGYSNQDVIEMIRNRQILPCPDDCPP
WVYTLMIECWNEFPNRRPRFKDIHNRLRTWGNISNYNSSAQTSGASNTTQTSSLSTSPVS
NVSNARYIGPKQKTQSFPQPQFIPVKGQIRPMVPPPQLYIPVNGYQPMPAYGAYLPNFYP
VQIPMQMAPQQMPSQMIPKPGSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTDDALN
TVEDIAQNPVQEEEEEGSVPETELLGDNDTHLQVDEAEVLSEA
Download sequence
Identical sequences F6RDI3
ENSMODP00000024012 ENSMODP00000024012 XP_001378164.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]