SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024018 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024018
Domain Number 1 Region: 76-347
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.64e-70
Family Crotonase-like 0.00000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024018   Gene: ENSMODG00000019240   Transcript: ENSMODT00000024445
Sequence length 348
Comment pep:novel chromosome:BROADO5:3:834905:932153:1 gene:ENSMODG00000019240 transcript:ENSMODT00000024445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGGLGVLQGCRVRLLAAYFARLGPGLVTRGSGQRLWRTSERRCWPSVSAGSGLSRSY
GSEAKGDEELRVRYLEEENKGIVVLGINRSYAKNSLSKNLIKMLSKAVDALKSDKKVRTI
IVRSEVPGIFCAGADLKERAQMSLSEVSSFVSKARTLMNEMANLPVPTIAAIDGTALGGG
LELALACDIIVAASSAKMGLVETKLAIIPGAGLGPLFLIQNLDPPSVGGTQRLPRAIGMA
LAKEMIFSARVLNGQEAKSIGLISHVLEQNEAGDAAYRKALALAREFLPQGPVAMRVAKL
AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLRAFKEKRPPRYKGE
Download sequence
Identical sequences F6QU09
ENSMODP00000024018 ENSMODP00000024018 XP_007486272.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]