SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024041 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024041
Domain Number 1 Region: 841-925
Classification Level Classification E-value
Superfamily DEATH domain 7.85e-24
Family DEATH domain, DD 0.0000465
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-16
Family I set domains 0.022
Further Details:      
 
Domain Number 3 Region: 259-310
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 313-367
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 62-164
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000174
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024041   Gene: ENSMODG00000019260   Transcript: ENSMODT00000024468
Sequence length 931
Comment pep:novel chromosome:BROADO5:5:27262865:27666480:1 gene:ENSMODG00000019260 transcript:ENSMODT00000024468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKGLEATAARCGLGLGYMLQISVLPALAILSASSPGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPMAEVEWLKNEEIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGFQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTAWSKWSTCGTECTHWRRRECSSPAPKNGGKDCEGLVLQSK
NCTDGLCMQTAPDSDDVALYVGVVIAVIVCLAISVIVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSDFTAKLSPQITQSLLESETLNLKNQSLARQTDPSCTAFGTFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPVEDSQTLLTPVVSCGPPGAL
LTRPVILTMHHCAEPETEDWKIQLKTQTPQGHWEDVVVVGEENFTTPCYIQLDLEACHIL
TETLSTYALVGQSTTKAAAKRLKLAIFGPLSCSSLEYSIRVYCLDDTQDALKEVLQLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLIAKYQEIPFYHIWSGCQRNLHCT
FTLERFSLTTVELVCKLCVRQVEGEGQIFQLSCTVSEEPTGIDFPLLDPASTITTITGPN
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAADGQY
Download sequence
Identical sequences F6Q8P2
ENSMODP00000024041 13616.ENSMODP00000024041 XP_001365211.1.35504 ENSMODP00000024041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]