SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024115 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024115
Domain Number 1 Region: 664-1344,1374-1531
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-195
Family Motor proteins 0.0000000226
Further Details:      
 
Domain Number 2 Region: 211-310
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000381
Family PDZ domain 0.0051
Further Details:      
 
Domain Number 3 Region: 1733-1850
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000301
Family Myosin rod fragments 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024115
Domain Number - Region: 1537-1632
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.023
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 1820-1933
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0366
Family Myosin rod fragments 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024115   Gene: ENSMODG00000019323   Transcript: ENSMODT00000024542
Sequence length 2127
Comment pep:novel chromosome:BROADO5:2:507111191:507228930:-1 gene:ENSMODG00000019323 transcript:ENSMODT00000024542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNLMKKDKDKDGSRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL
EISNPIPIKVASSSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEESGRPSVLQRA
AKFGSLAKQNSQMIVKRFSFSQRSRDGSASETSTPSEHSAAPSPQVEVRTLEGQLARQAG
SSVSWPGCRTRGPELVSKRFAADLRLPAVAPLLPPPPRELELQRRPTGDFGFSLRRTTML
DRAPEGQAYRRVVHFAEPGAGTKDLALGLVPGDRLVEINGQNVENKSRDEIVEMIRQSGD
HVRLKVQPIPELSELSRSWLRSGLGQQREPTDVKDEDKIIPKPSPLGKEERALEGAPKDK
ACPLRSPQSPTTPVPAEPRQRPSSPADVSNGVPPVPSVNGLGTASPGPQMEDPQGASCHR
VAKAVRKVVSKVLPGDEPGGAREPPAKGAKLPDPPAHGKKGGKAPRVPAAPTPPPLPSKP
EAKKEPAAKDEISVGLRSLMSRGRGKEHKPRSRPASEKAGERPPGPPEGPAETPGSLAQP
ESEKKPSSPTPPKEEPDRVQDVVPGSDHAPAELAQVPAPGTQQEAGAIVEAQPVPGEEAQ
ERLERIFMTSLDPEAFSAAQSQAKTEEQIAAEEAWHETEKVWLLHQDGFTLASQLKSEEL
SLPEGKVRVKLDHDGTILDVDEGDVEKANAPSCERLEDLASLVYLNESSVLHTLRQRYGA
SLLHTFAGPSLLILSPRGAPAMYSEKVIHMFKGCRREEMAPHIYTVAQTAYRNMLMNRQD
QSIVLLGSSGSGKTASCQHLVQYLATIAGTGGNKVFSVEKWQALYTVLEAFGNSPTIMNG
NATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPSNEATFNVFYYLLACGDSTLRT
ELHFNHLAENNVFGIVPLSKPEEKQKAAQQFSKLQAAMKVLGISPDEQKACWFILAAIYH
LGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQPKGSLQRSTSFRQG
PEESSPGDAAGSKLSALECVEGMAAGLYSELFTLLVSLVNRSLKSSQNSLCSMMIVDTPG
FQNPDLGGSTRGASFEELCHNYTQDRLQALFHERTFVQELERYKEENVELAFDDLEPGAV
DSVDAVDQASQQALVRSLARPDEARGLLWLLEEEAMVPGGTDEALLERLFSYYGPQDGDK
KGQSPLLRSSKPHHFLLGHSHNTNWVEYNVEGWRNYAKQNPAMQNAPRLLQDSQKKIISN
LFVGRAGSAMVLSGSIAGLEGGSQLALRRATSMRKTFATGVAAVKKKSLCIQIKLQVDAL
IDTIRKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPPGEHCETGLLPLDIPLL
RAQIRGSRLLDALRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDEKRAVEEL
LESLDLEKSSCYMGLSRVFFRAGTLARLEEQRDEQTSKNLTLFQAACRGYLARQHFQKRK
VQDLAIRCVQKNIKKNQGVKDWPWWRLFTAVRPLVEVQLSEEQLRGKDEEIQQLRGKLEK
VEKERNELRLNSDRLETRISELTSELADERNTGESASQLLDAEAAERLRAEKEMKELQIQ
YDALKKQTEAMEIEVMEARLIRATELNGEMDDDDSGGEWRLKYERAVREVDFTKKRLQQE
FEDKLEAEQQSKRQLERKLVDLQADSDESQRTHQQLKKKCQRLTAELQDTRLHLEGQQVR
NHELEKKQRRFDSELSQAHEETQREKLQREKLHREKDALLAEVFSLKQQMEEKDMDIAGF
TQKVVSLEAELQDISSQESKDEASLAKIKKQLRDLEAKTKDQEEELDEQAGTIQMLEQAK
LRLEMEMERIRQTHSKEIEGRDEEVEEARQSCQKKLKQMESQLEEEYEDKQKVLREKRDL
ESRLNALSDQVSQRDLESEKRLRKDLKRTKALLADAQIMLDHLKNSAPSKREIAQLKNQV
LGRDGSVSLRRAALEGPRESSGPAPVEEIVRPRRITQEDSHPGAGGPARLLSAHSARCPC
LGWRALPRGLFNPIAIGPFLGVLELDSLGKKRQSSPNYCLSLPSDMPSCPPQGLWNGGQH
FPHGAAEAACHLVPSAAPLVNGLRASE
Download sequence
Identical sequences F6XTD1
ENSMODP00000024115 XP_016284739.1.35504 ENSMODP00000024115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]