SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024135 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024135
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.84e-76
Family Biotin dependent carboxylase carboxyltransferase domain 0.000000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024135   Gene: ENSMODG00000019339   Transcript: ENSMODT00000024563
Sequence length 269
Comment pep:novel chromosome:BROADO5:Un:97703432:97707842:1 gene:ENSMODG00000019339 transcript:ENSMODT00000024563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIQQAGQVWFPDSAFKTAQAIKDFSREKLPLMIFANWRGFSGGMKDMYDQVLKFGAYIVD
GLRQYKQPVLIYIPPFAELRGGSWVVIDPTINPQCMEMYADKESRGGVLEPEGTVEIKFR
KKDLIKSMRRIDSIYMKLLDQLGVENLSEKEQRELESRLRAREEHLLPVYHQVAVQFADL
HDTPGRMQEKGVITVKGISQCAALPRREGLWRDVLEWKNARTFLYWRLRRLLLEDVVKNE
ILQANSELSHIHIQSMLRRWFMETEGTVK
Download sequence
Identical sequences H9H7B3
ENSMODP00000024135 13616.ENSMODP00000024135 ENSMODP00000024135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]