SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024170 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024170
Domain Number 1 Region: 569-736
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-38
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 386-567
Classification Level Classification E-value
Superfamily Fibronectin type III 8.64e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 3 Region: 176-225
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000018
Family B-box zinc-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024170   Gene: ENSMODG00000019370   Transcript: ENSMODT00000024598
Sequence length 739
Comment pep:novel chromosome:BROADO5:1:112945242:113018182:-1 gene:ENSMODG00000019370 transcript:ENSMODT00000024598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERTGRAPLYSQDPGSGPTASQSFNFYPMDLYDSEDRLNIFPEEKIRTREVAQEPKKGE
RAPELSSATQVEELARYYGLEEDKEFEGETEAGSALRSGISEYQSAPSLRSHNVPKRRED
KDWQYLEEAADAEDDRFPGWGSRGQYQELREAYRYTRGRSSEDYECYVIPEEEDEEEAAD
IFCVTCKIPIRAFDNLFGEHKEHEVTQLNTAAENARDEIHKNMFKLEEQIIQMENFASHL
EEVFITIEENFGRQEQNFELHYNEILETLAQKYEEKMQALGEKKREKLEALYGQLVSCGE
NLDTCKELMETIEEICHEEKVEFIKVNNDKGEKLGEFLKTKTDAELSTHPDFEDQTIDFS
DVEQLMDSINAIPAPCAPVINTQTPNSATGTSVKVCWSLFSDDTVESYQLSYKPVSDGAP
TEEQKEFSVNVKESHYSVANLVPNTQYEFWVTASNSTGVSPPSERAVYVTAPSPPIIKSK
EILSCEHAALVCWESGNMNPVDSYTIELSKVDNEDSGNVVTESIVGIPTCESLIQLQPGE
SYLVYVRAINVGGPSERSEPATIHTTGSYFHLNKDTSHPLLSISEDGFTVVRGKGEKSAR
EPLESDTRFTRCVAVMGSLIPIKGRHYWEVQVDEQMDYKVGVAFQDISRHGELGADSSSW
CMSHTFTSSRHKYEFLHNGATPEIQITVPPKKIGILLDYDSYRLSFFNVDIAQHLYTFSY
PLQHFVQPCFSLEKPGMLR
Download sequence
Identical sequences F6WSS4
ENSMODP00000024170 ENSMODP00000024170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]