SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024198 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024198
Domain Number 1 Region: 277-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-41
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 6.45e-19
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 85-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000366
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024198   Gene: ENSMODG00000019397   Transcript: ENSMODT00000024627
Sequence length 485
Comment pep:novel chromosome:BROADO5:1:117149674:117152729:1 gene:ENSMODG00000019397 transcript:ENSMODT00000024627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKNLLESLKVDLTCPVCLGYFTDPVIAKCGHSFCKKCLLRCLEDVNTPGTCPECRTII
QYGDFLCNRRLQSLAMVGKLFKPHLIESLTICDKHKKEEYLFCENDHRPLCRSCFLTTEH
KEHKVFPLEKAAGQFMMELQKTWKILRERKETFQMELERERNREVQLKLEGQAMKQLIMS
KYKKKHQFLLEEEWIHLQRLDQEARENMAKFEESEAGLSQLIHNLQMVMSEVENNFDKSF
FEMIKDVKGILGRKEKLLLQDPVVASPRWTKFSIPGMTEMLMTFQRDLTLDPETANSHLI
ISKDLKSVRYVSIPQDLLADNIEQFDFPIALLAIQSFISGKHYWEVEVKDEIQWQVGICK
ISDNKKRQLLLCLEHTSIGFQLRNDFDFWNSYDNIHVSSPIHKLGIFLDYERGQITFYNA
IDRTLIYNPPKVAFYISPLTHVIKQLFFFCVSTPTVFPLNVDSVPSHKSLRIVLDHCIAT
NGEDH
Download sequence
Identical sequences F6WC71
13616.ENSMODP00000024198 ENSMODP00000024198 ENSMODP00000024198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]