SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024263 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024263
Domain Number 1 Region: 361-480,672-996
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.32e-73
Family Integrin alpha N-terminal domain 0.0000749
Further Details:      
 
Domain Number 2 Region: 132-271
Classification Level Classification E-value
Superfamily Translational machinery components 2.68e-52
Family ERF1/Dom34 middle domain-like 0.0000367
Further Details:      
 
Domain Number 3 Region: 500-692
Classification Level Classification E-value
Superfamily vWA-like 6.82e-51
Family Integrin A (or I) domain 0.0000000315
Further Details:      
 
Domain Number 4 Region: 1-130
Classification Level Classification E-value
Superfamily Dom34/Pelota N-terminal domain-like 2.49e-46
Family Dom34/Pelota N-terminal domain-like 0.00066
Further Details:      
 
Domain Number 5 Region: 999-1150
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-29
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 6 Region: 262-352
Classification Level Classification E-value
Superfamily L30e-like 1.41e-22
Family ERF1/Dom34 C-terminal domain-like 0.00000552
Further Details:      
 
Domain Number 7 Region: 1153-1277
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-21
Family Integrin domains 0.0067
Further Details:      
 
Domain Number 8 Region: 1286-1485
Classification Level Classification E-value
Superfamily Integrin domains 1.73e-20
Family Integrin domains 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024263   Gene: ENSMODG00000019448   Transcript: ENSMODT00000024693
Sequence length 1519
Comment pep:novel chromosome:BROADO5:3:14917710:15100868:1 gene:ENSMODG00000019448 transcript:ENSMODT00000024693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLVRKDIEKDNAGQVTLVPEEPEDMWHTYNLLQVGDSLRASTIRKVQTESSTGSVGSNR
VRTTLTLCVETIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSV
VLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRRGNCSQHDR
ALERFYEQVVQAIQRHIHFDVVKCVLVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKF
LQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE
KANEALAIDTLLISDELFRHQDVATRSRYVKLVDSVKENAGTVRIFSSLHVSVVLGFCVS
FNVDVKNAMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLVGQPKNRTGDVYKCPVGRGE
SLPCIKLDLPVYTSIPNVTEVKENMTFGSTLVTNPKGGFLACGPLYAYRCGHTYYTTGIC
SDVDSKFQVVNSIAPSVQGCNTQLDIVIVLDGSNSIYPWTSVTDFLNSLLGKMDIGPKQT
QVGIVQYGENVTHEFNLNKYTTTEEVLIAANQIVQRQGRQTMTALGIDTARKEAFTKARG
ARSGVKKVMVIVTDGESHDNHRLNEVIQDCEDEDIQRFSIAILGHYNRGNLSTEKFVEEI
KSIASEPTEKHFFNVSDELALVTIAEVLGERIFALEATTDLSAASFEMEMSQTGFSAHYS
QDWVMLGAVGAYDWNGTVVMQKDNQIITPQNNSFNVESTKKNEPLASYLGYMVNSATIPG
DVIYIAGQPRYNHTGQVITYTMEGQEIKIIQTLNGEQIGSYFGSVLTTIDIDKDSFTDLL
LVGAPMYMGTEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSLKHDSCKKKNKNEPCG
ARFGTAIASVKDLNLDGFNDVVIGAPLEDDHGGAVYIYHGSGKTIRKEYAQRIPSGGDGE
TLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAEVKVTMAFAPNKVNIQKKNC
KMEGKETVCINATMCFNVKLKSKEDTIYEADLQYRVTLDSVRQISRSFFSGTQERKIQRN
ITVRGSECIKHYFYMLASKSCIIADKHDFRDSVKVSLDFNLSDPENGPVLDGDLPNSVYE
YIPFAKDCGNKEKCISDLALTVSTSGKDLLIVKSHSDKFNVSLTIMNKKDSAYNTRAIVQ
ASPNVIFSGIEGIQKDSCESNQNITCKVGYPFLKGGEEISFKILFQFNTSYLTDNVTIHI
SVTSDSEEPLEALFDNEVDISIPVKYEAELQFSSSASEYHISIAANDTVPDIINSTSDIG
NEINVFYSIQKSGHIPIPELSLKISFPNLTSNEYPVLYLTGWSSSDNVNCRPRSLQDPFN
IKFGKKMIPKSGELKRGTILDCDTCKYATIKCNVIPSDKSQVNVTFILWKSTFIKASFSS
LNLTIKAELQSENSSLVLSSGNQKRELAIQISKDLVPGRVPLWVILLSAFAGFLLLMLLI
LALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences F6RXG9
ENSMODP00000024263 ENSMODP00000024263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]