SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024292 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024292
Domain Number 1 Region: 43-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.01e-29
Family Laminin G-like module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024292   Gene: ENSMODG00000019472   Transcript: ENSMODT00000024722
Sequence length 2222
Comment pep:novel chromosome:BROADO5:3:17149994:17214520:-1 gene:ENSMODG00000019472 transcript:ENSMODT00000024722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVIFNQRDILSSLRSYPGLKKVHEVSLGCSDEFFAGENEAVNFFSSKSYVAFPRWNSQ
EEGLWEFTFQTGADQGLLLYQSGRSGDFVVLEIEAGLIKAYVGKNQTKTELPSLGFISDN
EWHFVQLQLNKRYFSLVVDEERVGISLPLYSGAFECKGPLFVGGVDSNARAEIKKLGLTS
VSRKSGRGGSFKGCLRSLKVNSKKLSLKNALVSKDISAGCNTKSNDISSLPKITTEKMTL
QTRAPPSSTPLESVKSSLQEDSSYFLHLNNLVVQEGGRAPVENKHIRMNSEFKEFDIHHS
QVLFQIKEKTIHGDLRLDVAPESQVEATFTMLDLWQERVLYVHDGSESTRDHFVFSVSLS
KEKEIPFHLQRNDQYVFNITITPVNDPPELFLPEGNLLLLLENSKKRLTSNMIKVLDPDT
PPSDLTFSVLGNFNADTGYLENTKHPGKIINTFTNEDLQGGRIFYVHHGLQNSRIVLRVS
DGELVSNTAVLRVKTIPWNYKVVNNTGVAVQQGSTVLITQSNLSVQLNAGGHEMEIRYNI
IHPPLFGQIQRRSSSGEWKPVNIFSQRSIDRDRVRYCSTFKESQMENVTDHFIFKISIEN
EVSEELVFPIAIQWLKYKLVKNGPLDINTMDKKRLTSDHLMVRMENMEVLESELHFKVLS
LPKKGKLLLGSRILKQNSTFSQKNIMDGEVAYELLEKSQETTQDSFRFLICTNHIESKIY
VFKINIRADPNHIILINKGFSVTEGEGKLITKTELFAQTLDSQVFHYKISKSPQHGKLKL
MNFSNSLESSDYITTFTNQDIIDERLMYVHDDSETEYDEFVVEASAKGPRNEEARVDLEI
KVNVTVAPKNDEKPMRVVDKVFHVVRNGQRLLTLMDLCYHDPDSDFNDRQLLYTRRGIPN
GDLVLAGDPSQKLYQFHQGDLEEGRVLFRHHGADYARFVLFVTDGTHYSSSLLEVSASEP
YLRIANNTGLLVLKGRQETLTTANLSVTTNHDIRSDSEINYEIFLLPKYGRILVKNRSSA
SFSQHDLKQGYVIYRHDGNNNFADMFNLTAKAKDIHLDVGIYVQVYLESHQHPPKVVHSK
SLLVEEGKSVKLSRRELQAVHENNSPSEIMFIIRNPPVHGQLRKFVTEDDLGANEDSPSS
FTQQDVDDGHIHYEQTASDQEQDRFLLDVTNGIQTIRGIEILVDIIPRLIPLVAQNFTVL
ESGSRSLLEDFLKIPNPHFVGISCEFVLVEQPKHGHIENSHFPRIRLMKFTRNEMEKELI
YYVHDGSEELLDTFTVFVNNTELGKQSLPQTVFVMVKPVNDEAPVIVANKILRVWVNSST
EITRNDLRAEDTDSSPGELAYSVTLPSNGHLALKSFPNRSILNFTQAHINEGRLVFVHTG
AMSGGFSFQVTDGLNFAPRQIFSITAQALVLSLEANKGLGVFPGSTKPISSHVLKAVTND
GDSAGNRTITFTVLSSPKLGRLIRLDSGNDTQDVSAFTQHAVDEGLIAYQHADRELPVWE
AEDSFTFTASSPPAALGPQLFAVTISYDIHEPGRHSRLLANTGAVVREGGSVLIDRSKLD
ASNLLVRLPAAQRAAHDVWYRVTALPHHGTIVVGGRNVTQEEPCFSQHTIDEYGITYEHD
DSESLADNFTFAVWLNQKGASAARPDAAVLEEVFHVAVSPVNDQAPTLKTEGLSLRVLQG
DTLRVGPDHLKVEDLDSPPEEIRYAVIGHPSNGFLARTPHLDLPIDQFTQADIDRGHMWF
VQDGSPSSGAFYFSVTDGTHGPLYKLFRLEVIPVSVSLLNLTDLLLPQGQTSAAITNAHL
WAVTHGRSPEITYELLRPLQHGHLLLGHERVTSFKQEDVSSGRLCYHMTDLTASQDTLQF
LLRTAEHQLPGQALHIRVQPLLRLAPGPAIPNRATYQLRREDLDATQLAHLTNSIPRFEV
TEPPVHGRLVRRVSRQAEPEPIDLFTQRDIDQGVLMLDTHANMSAADALNDSFTFTLRAD
HVQPAVGRFPYTIVLPEPFSGQSSTPEGPAPSEGPPTSTGSPESSTAPLGPRTQTEGQRK
LAQARSLDSTLWGNQKRGDTAAEPEIPITQVWPEASTEASSRPARAQPRGSTNPLVIIIP
LSVTTFLLIVAVMSLCVCLMCRQAKKAEPIIDAPTSLEPRTSSPSPERSAAIPSVTVTPL
ERSSSSPAVSPYLAPTCQRLLTPEAKPLEKVSLWDAWMNLDPEMVQHCRKTNPTLRRNQY
WV
Download sequence
Identical sequences F6RBC9
ENSMODP00000024292 ENSMODP00000024292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]