SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024343 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024343
Domain Number 1 Region: 438-491
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000153
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 2 Region: 50-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000299
Family Ubiquitin-related 0.014
Further Details:      
 
Domain Number 3 Region: 284-362
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000641
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 4 Region: 359-424
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000165
Family IBR domain 0.028
Further Details:      
 
Domain Number 5 Region: 199-226
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000106
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024343   Gene: ENSMODG00000019512   Transcript: ENSMODT00000024773
Sequence length 516
Comment pep:novel chromosome:BROADO5:1:402867053:402888201:1 gene:ENSMODG00000019512 transcript:ENSMODT00000024773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKTKKVEEMALKLARAVAGGDEKMAVTCATWLAKNRTPLTLQLISEVYPKQEIKLWVG
MEDAQMHTLHIWLMVRPNMTVASLKDMVFLDYGFHPSLQRWVIGQRLPRDQDTLHSYGVR
QDGDKAYLYLLSAHQTQLSQQELQRQRQLRVLEDLGFRDLALQSRGPQEPRPMEPPENVL
SEAVGTTAPSTVETAPDPSVAGWGCPGCTFVNKPTRPGCEMCCAARPEGYQVPSSHQPDE
EEQARLQNEEESLRQYHLRKQIQQEGNYLELLQLDQRSLVLSTEAVECPICYLSLGPGEG
VVLRECLHAFCKDCLQGTILNSQEAEVSCPYIDDTYSCPGKLQEREIRALLSPEDYQRFL
DLGISIAENRSAFSYHCKTHDCRGWCFFEDDVNEFTCPVCGRVNCLLCKAIHENMNCKEY
QDDLALRAQNDVAARQTTEMLKLMLQQGEAMHCPQCQIVVQKKDGCDWIRCTVCHTEICW
VTKGPRWGPGGVGDTSGGCRCRLNGIPCHPSCQNCH
Download sequence
Identical sequences F6VDA7
ENSMODP00000024343 ENSMODP00000024343 XP_001363445.1.35504 XP_007474546.1.35504 XP_007474547.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]