SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024440 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024440
Domain Number 1 Region: 82-197
Classification Level Classification E-value
Superfamily Translational machinery components 1.05e-38
Family Ribosomal protein L18 and S11 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024440   Gene: ENSMODG00000019589   Transcript: ENSMODT00000024874
Sequence length 197
Comment pep:novel chromosome:BROADO5:1:123649608:123660162:-1 gene:ENSMODG00000019589 transcript:ENSMODT00000024874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLGILSRRFFPLRTWAHALGARNDARGCALHTGSQRSLEVVEKTEEETEVEPGDAQKR
STFSIFPPVPDQESSLTWGGKKYEEIPIAHIKATYNNTHIQVVSSRNEPFARTSCGTEGF
KNAKKATGIAAQTAGIAAAVKATAKGVIHVRVVVKGLGPGRLSAIKGLTMGGLEVISITD
NTPIPHNGCRPKKARRL
Download sequence
Identical sequences F6Y8U7
ENSMODP00000024440 ENSMODP00000024440 XP_007479442.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]