SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024460 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024460
Domain Number 1 Region: 1086-1127,1158-1199
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000883
Family Fibronectin type III 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024460
Domain Number - Region: 667-697
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family Merozoite surface protein 1 (MSP-1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024460   Gene: ENSMODG00000019604   Transcript: ENSMODT00000024895
Sequence length 1352
Comment pep:novel chromosome:BROADO5:1:407206581:408352182:-1 gene:ENSMODG00000019604 transcript:ENSMODT00000024895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPSSPGLGLRWQLRLRLRLGSGSGRQSLLPPPPSAPAPLLPLLLLLASGPGSSASREP
DSSCRLKTVTVSTLPVLRESDISWSGGRAGAGAGAATAAAAAAAAAAAAAAGSLGSGGSG
SGGPGSPVESRLLLFVRNELPGRIAVLDDLDNTELPFFTLEMSGTAADISLVHWRQQWLE
NGTLYFHVSMGSAGQLSRATPPTLQEPSEIVDEQMHILHISVMGGLIALLLLLLVFTVAL
YAQRRWHRRRRVPQKSASTEATHEIHYIPSVLLGPQARESFRNSRLQAHNSVIGMPIRET
PILDDYDYDYEEEEQPRRTNHVSREDEFGSQVTRTLESLGQPSEEKMDFEKKAAEVTQET
VESLMQKFKESFRTNTPIEIGQLQPALRSASAGRRKRRSKSRGGIGFGRTKGNSGSEADD
ETQLTFYTEQYRSRRRSKGLLKSPVNKTALTLIAVSSCVLAMVCGNQLSCPLTVKVTLHV
PEHFIADGSSFVVSEGSYLDISDWLNPAKLSLYYQINATSPWIRDLCGQRTTDACEQLCD
QETGECSCHEGYAPDPVHRHLCVRNDWGQSEGPWPYTTLERGYDLVTGEQAPEKILRSTY
SLGQGLWLPVSKSFVVPPVDLSINPLASCKTDVLVTEDPADVREEAMLSTYFETINDLLS
SFGPVRDCSRNNGGCTRNFKCVSDRQVDSTGCVCPEELRPMKDGTGCYDYSKGIDCSDGF
NGGCEQLCLQQTLPLPYDASSSTIFMFCGCVEEYKLAPDGKSCLMLSDVCEGPKCLKPDS
KFNDTLFGEMLHGYNNRSQHVNQGQVFQMTFRENNFIKDFPQLADGLMVIPLPVEEQCRG
VLSEPLPDLQMLTGDIRYDEAMGYPMVQQWRVRSNLYRVKLSTITLSAGFTNILKILDKD
SSREELLSFIQHYGSHYIAEALYGSELTCIIHFPSKKVQQQLWLQYQKETTELGNKKELK
SMPFITYLSGLLTAQMLSDDQLISGVEIRCEEKGRCPSTCHLCRRPGKEQLSPTPVLLEI
NRVVPLYTLIQDNGTKEAFKSALMSSYWCSGKGDVIEDWCRCDLNAFDANGLPNCSPLPQ
PVLRLSPGVEPSSTVVSLEWVDVQPAIGTKVSDYVIQHKKVDEYTDTDLYTGEFLSFADD
LLSGLGTSCVAAGRSHGEIPEVSVYSVIFKCLEPDGLYKFTLYAVDTRGRHSELSTVTLR
TACPLVDDNKAEEIADKIYNLYNGYTSGKEQQTAYNTLMEVSASMLFRVQHHYNSHYEKF
GDFVWRSEDELGPRKAHLILRRLEKVSSHCSTLLRSAYIQSRVDTIPYLFCRSEEVRPAG
MVWYSILKDTKVTCEEKMVSMARNTYGDSKGR
Download sequence
Identical sequences F6Y7H9
ENSMODP00000024460 ENSMODP00000024460 XP_007474599.1.35504 XP_007474600.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]