SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024489 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024489
Domain Number 1 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 238-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 186-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 384-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024489
Domain Number - Region: 352-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family Laminin-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024489   Gene: ENSMODG00000019630   Transcript: ENSMODT00000024925
Sequence length 586
Comment pep:novel chromosome:BROADO5:1:413127114:413253073:-1 gene:ENSMODG00000019630 transcript:ENSMODT00000024925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLPILGGIALLCCVAAVAAAASVPASASASPAASAAGTVPTPAGERDRAPSPPPSRAA
DTGGDGDQDPAAAEQVEEPVSHAPIPVSFAASPAAEGTTELEPEPTSTRTEAVPSGSSSI
LTRAPQVLTPTPTATMILTTTTQTVAATPTATLTLTPSVLWNEPSPTPPADQPGNEASPT
PREHMCNCSKVGSQDGNPCNQTTGQCECLPGYKGLHCDFCEEGFYPASTKIQGLCWSCDC
EPHGSISPTCSSSGKCQCKEGVGGSKCDHCQDGYYGFNETGCQPCQCNNQSVICDPFSGT
CLKCQGNSKGDHCEECKDGFYKSPTSFHKCLRCPCSAVTSTGNCSIHSGELVPKCDQCKA
GYTGPNCNICENGYYNSDSICMKCECSGHVDAIRTPKICKPESGECIDCLHNTTGFHCEN
SQDRIVSVHRGNCIKKEIVVTTTEGSTTLVSNATLSTSPLTTVANSTFTPTTLQPIFSIG
SSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYTYREYQNRKLNAPFWTIELK
EDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences F6XPU1
ENSMODP00000024489 ENSMODP00000024489 XP_007474615.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]