SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024533 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024533
Domain Number 1 Region: 44-229
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.87e-32
Family DJ-1/PfpI 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024533   Gene: ENSMODG00000019666   Transcript: ENSMODT00000024969
Sequence length 231
Comment pep:novel chromosome:BROADO5:Un:54361054:54366894:1 gene:ENSMODG00000019666 transcript:ENSMODT00000024969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPACPDLSLQGRPCPGTGGTEGGRDRFLPSGVSAHSFLHCFTLGSAAFNLQVATPGGK
AIDFVGMNESNTRWIQDFRVKAYASPAKLESIDGARYHALLIPSCPGALTDLANSGYLAR
ILEHFSAEQKPFCPVGHGVPPFCCATKEDNFWVFRDYTLTGPSVGELIREPGFGGLPVIV
EDFVRDAGACFSASQPDAAHVVLDRHLVTGQNDASTVLAVQNLVLLCGGRK
Download sequence
Identical sequences H9H7E0
ENSMODP00000024533 ENSMODP00000024533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]