SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024568 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024568
Domain Number 1 Region: 68-576
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.12e-190
Family Myeloperoxidase-like 0.0000000000000492
Further Details:      
 
Domain Number 2 Region: 27-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024568   Gene: ENSMODG00000019692   Transcript: ENSMODT00000025004
Sequence length 594
Comment pep:novel chromosome:BROADO5:1:415906570:415959438:1 gene:ENSMODG00000019692 transcript:ENSMODT00000025004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWSHLSVGLLLLMQTVSPAPETPSTVNPCCYFPCQHKGVCVRFGLDQYQCDCTRTGYYG
PKCTTPELWTRIREALRPSPSFYHFILTHGRWIWNIINTTFIRDVLMRLVLTVRANLIPS
PPTYNSYHGFISWESYANLSFYTRVLAPVPEDCPTPMGVKGKKELPDPELLARRFLLRKE
FVPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPAFTKALGHGVDLGHIYGDNLQRQYQLRL
FKDGKLKFQMVDGEMYPPSVTETQASMRYPANVPESQQMAVGQEVFGLLPGLMMYATIWL
REHNRVCDILRAEHPTWKDEQLFQTARLILIGETIRIVIEEYVQHLSGYFLKLKFDPEML
FGIQFQYQNRISLEFNHLYHWHPLMPDSFVVGDQEYSYEQFVFNTSMLLDYGVEALVDAF
SRQRAGKIGGAKNINHHILHVAISTIKESRELRLQSFNEYRKRFGMKPYTSFQELTGEKQ
KSAELEELYGDIDALEFFPGLLIEKSLPNSIFGESMVEIGAPFSLKGLLGNPICSPEYWK
PSTFGGETGFNLVKTATLQKLVCLNVKMCPYVSFRVPDPDQVDKQSVKRPSTEL
Download sequence
Identical sequences F6TCZ7
ENSMODP00000024568 ENSMODP00000024568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]