SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024599 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024599
Domain Number 1 Region: 3422-3583
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-34
Family SPRY domain 0.0006
Further Details:      
 
Domain Number 2 Region: 3226-3417
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-21
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 3 Region: 3030-3079
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000572
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024599   Gene: ENSMODG00000019711   Transcript: ENSMODT00000025035
Sequence length 3591
Comment pep:novel chromosome:BROADO5:3:36185917:36264911:-1 gene:ENSMODG00000019711 transcript:ENSMODT00000025035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRLTDQNEEDKTKQECIISDPSFSMVTVQREDSGITWETSSSRSSTPWASESSLTSDMYS
LEGSTLSSPPGNISFILDEGKKVRKRTHKSSSKHGSPALRRKGGKKRHSLEGQADVPANT
KDNALISDGKLPGTEQEKSSIGTYDKTRKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTV
QYKIKMFNSVKEEIIPLQFYGTLPKGYVIKEINYRKGKDASITLEPDLGNQDSSISSKAN
KSMTQIIESNKEKQLSPPWREKMSRESRPMPSFLRDVEQPKDIDSYSPLNAAAASGPKHT
VPSYSSNEAVESQSLPSSLSTLPVEEAPMRKIQMDSPDAAAFELASPKMVKEELTPETQA
EASSPLLSTSPSFVDEVGEENLTSSKAEEEALELDSQVTAVSAPEPFGTNVENLGQSSLE
KEELVSPTGEEETEETEPESSVSFSKPSAVGEIKEEGDGSLPVTSRPELEPSYVSEEEII
EIDYPESPSPSENAIPPHLVHEEEREENESDLPLLATSTSEHVALLEKERKEIGPISPDS
DFASEFSGPSYSTHELEEKETKPVSPPDIMSTSESEILSEEEIVPYSPGFTSVAEHSMTS
PTAEEESIEYKPPIHSAATSGPAIFSEEETLESERYTPDSTSASEYSIPPYAAQELQKED
TSQRSPLSPLAATDHMIMSEEEKDDIGPYSPDSAFVSEYSVSPRTVQESEKEEFEQDYPI
HSTSPSEHTLTEEEHDETEPFSPDSASDISIPAYKTPEPEKETEPGSLLTSMSVSEYSIF
SEAEKEEIEPKTQASTMSAPDHPTLSDRQKVQHSSIEPRSENLNLPSSTAGVEKEEVKPD
AQGAATSVSEYLISSQKQKIEGPSQVRESEHSMPPSSTAGVEKEEVKPDAQGVATSVSEY
LISSQKQKIEGPSQVLESEHSMPPSSTAGVEKEEVKPDAQGVATSVSEYLISSQKQKIEG
PSQVRESEHSMPPSSTAGVEKEEVKPDAQGVATSVSEYLISSQKQKIEGPSQVLESEHSM
PPSSTAGVEKEEVKPDAQGVATSVSEYLISSQKQKIEGPSQVATSVSEYLISSQKQKIEG
PSQVLESEHSMPPSSTAGVEKEEVKPDAQGVATSVSEYLISSQKQKIEGPSQVLESEHSM
PPSSTADEGKKEEISPHLSVPVAPVFKKADSSEKEKIGPVLPETSVSRPQESITSESTQK
TKKELGPKPAHAQKGASEHLAFSKASKEEIMLNSQVVPSEYPVSSQHKEMESHSPRTPEY
VTEPSVASVLSKERKGEVDSLSPPTEHLVLNKEEKEVGESGTSPIEKAASKPPIRSEVEV
DKVDKEVEVDKEEKNFQASPHDRYSTEHSISSKERQEEEEPRSPVPEHSVLSKVGNDQGL
PPLTVPATEHLTLSEKQTSESSPLASVTRSSVPPHMTIEGEKEDTKLPLLETTISASEHR
VSSQAKGETKYPSHELETLVTEEVSMKSVTPAGERSRQEPATLMPEKGHLLTERPDGPSL
RHTLEPEKTIMPPYALELSGSVSQNLVSECERENADQEKSLSPEIGSSGLERVKSEAKTR
EEGKQEHKDLSLSLSGPKPSKMKFSDLSEGLAKQKTTRYPDEVVNLPDLSTQDIAKSHSF
EEAHLPLEESKSVVTMECRDVKEAKESLPLPKEHIWVPGEPSQELAGPKEERLLESGQPY
SSATDGRLLGELTSAPKDSETALGDEKEDLGRTPHSFTEKKLLQESKADTSKVSKYADEA
QQPETKKPLPEARISSQEKSKLSLIQPKEITAPLDSPEIINKVPEQADTAATGALTESKA
KKGVSSFKSWMASLFFGASTPENDVDEKEAPETQPSPAADTAVLGDEAKTTVPAAPDDLN
EAEEPASSPLSMSGLLIEKEHPAILIKASEERELKETPLSLPNQVGKEPSKLTPLREEHK
TPGYRKEEMQSLSNRGMEMPSKEPASIKGKKLVSEEAESGAPIHFTGDNKVQKAEIYSPS
VTSQLIEKSKSVLTYLDEQQKLSSPEKVDQVSWPPKPATSEFADESFKKDSAKLEPRTLT
MEEPQGRLIKADGDRPEKEMTKTMSSTFYDDESKLRTVSSTDEENVPEQKPYCITEKDVL
AEKPEMVAPLILRDANKISMAEEPRLHKAEHAKESVFQFCENKEDEGMLSKIPVGVSVGS
EPPKSTAPATNENQIFSAERGMWEDSKPHPILGAREVSVDESQPLSFAKADFFKDSQIAS
VGPTEGHKEKSCQSPLLGKEKVISERSEAITVSSEEEVEQHLPGETNQRTQTYLAGKASF
ASEESGFTFGISYDETKNLKNQTCSLAKAKSVTGESQMALSVAHPEIKGTKISVISESSP
EVKRSQIPEVSTPELTGTGQAQQEKDRAPGSPILPTFVSKQISDSQIKPVEHLRVDKLYP
SAVHDSDQRTFDKPSTKSEEIFSTVAEEPENVFVKNGAFAAPVVTSKPPGLTEDQKNAFS
IISEGCEILNIHAPAFISSVDEEECEQMKDKLEYLEEKTSKSIQLFHDAREETTNQETVR
NKSHVGHLEEDVSLVKGQMQEKPLPAEENISTDSDVAFSSHMTPSDVDYFEKYTLIDYNI
SPEPQKRESLPKQDIEGEPQKKVSEETVSFLESSEDRTLECEFELVKLDESFYGMEKGDE
QVPHTQSQPSLLALQSATSETPRDIAREGESKSPGMPLFNAEEGVLSRTQLFPTEVKAIN
PELLEEPPALAFFYKDLYEEAVGDKKKEGEATSDGESLNSEASFPSRHSDAEEEAGMYFE
KYILKDDILHEASGYQKDQDQPLEEIPVGKDDSCQLIAAEGEVWGRFGTISGEMGMKEEQ
KAMLNEGEFRNSMENSKDKELQGKTPITEEVQLASQKISYAVPFQDAHHILERVDESDGQ
GIEEENASAEASQHIPVEVSYPEEEFVSGATPVPESLQVEPQELVAPEMREARPCSSPVQ
DEYEFAELMNYEVVTQADLLSDDLLSESTPEDVLSQGKESFELVGENDEFAKDAEQRRSA
PQKDLGSEVVEPEQLLAEMEDAQKEAKKSQIDTYCYTCKCPISAIDKIFGAHKDHEVAAL
DTAISVVKIQLGEFLENLKEKSLKIEAFVTEIESFFNTIEENCSKNEKRLEEQNEEMMKK
VLAQYDEKAQSFEEVKKKKMEYLHEQMVNFLQSMDTAKETLETIVKEAEELDEAVLLTSF
NEINDRLLSAMESTASLENIPTAFSLFEHYDDSSTRSDQTLKQVAVPQPPILEPQEPNSA
TSTTITVYWSVRKEDVIESFQVYCMEDPQEDSEANELVEEYRLTVKESYCLFEDLEPGRC
YQVWVMAVNFTGCSLPSERATFRTAPSTPIIKAEDCTVCWNTATIRWSSANPGASDAYTL
EYCRQHSPEGEGLRSYSGIKGFQLKVNLQPNDNYFFYAKAVNAFGTSEQSEAALISTRGT
RFLLLRETAHPALQISSDGTVIRFTERRRLTETPSVLGEQLPACGQHYWETTVTECPAYR
LGICSSSDMQASALGQGDTSWYMHCSEPQRYKFFSNGTVSNVHVTEHPVRVGILLDYSNQ
RLLFINAESGQLLFTIRHRFAGAVHPAFALEKPGQFTLHLGKEPPDFLRHK
Download sequence
Identical sequences F6TBQ7
ENSMODP00000024599 13616.ENSMODP00000024599 ENSMODP00000024599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]