SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024632 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024632
Domain Number 1 Region: 523-719
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-22
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 732-931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-20
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 945-1138
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-18
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 4 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000732
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 5 Region: 200-324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000895
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 328-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000135
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 7 Region: 424-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000046
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 1166-1206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 9 Region: 138-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000567
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 462-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000584
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1318-1355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000267
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1235-1276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000101
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 1200-1240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000155
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1280-1321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 50-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000123
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 365-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024632
Domain Number - Region: 90-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000261
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024632   Gene: ENSMODG00000019734   Transcript: ENSMODT00000025068
Sequence length 1430
Comment pep:novel chromosome:BROADO5:1:417353401:417395311:1 gene:ENSMODG00000019734 transcript:ENSMODT00000025068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAQSDSRSRSPLLLLLFLLPLPLSLSQTLPQEPSREPSGTWSSSGPSGCTSDPCTHGG
ICQDTSSGGFLCVCPTEPVAYVGTICEKLYDACSEQVCPENQTCHATPGALNHTCHCPPG
FGGPNCTSIDCGENGCLWSCTDQPCHHGGTCLATGASFACLCPPGWAGPLCEEDVDECMS
EPCQNGALCVDGPGGFLCYCVPGFQGPRCELDIDECASRPCKHGASCINRVDGYQCLCSP
GYTGLNCETEIDECVSVPCQNGGSCLDGVGFYQCLCSPGYTGHNCQVDIDECESQPCAHG
GICHNFIDRFQCNCSGTGFEGALCEVEVLECLSNPCQHNATCLDGLSNYTCVCLPGYHGE
HCEMDEDECKGAPCLHGGLCLQRSNQSLYGGAQPVFPGTFSYSSAAGFTCQCLPGFTGDN
CSVDVNECESEPCLNGGTCEDLPNSFQCHCLAGYTGLSCMVNVDDCASEPCFHGASCEDG
VNDYMCHCPPAWGGKDCSVLLTGCEGHACQHGAQCIPIYKAGAHSYTCHCLPGFHGPRCA
QSTTFSLAIGGSLLVALPAGDGHGQPAVSLRFRTTLPDGLLFSRGDTVESLTLMLSQGTL
WTILRSQGTELPLNLNTPSLSDGHWHRAEVVLLQSALELRLWHEACENGPCLKSHPLVGE
VALDSPAFLTVHVGGGAGTSPSFVGCLEDVRVDGHMLVPQDLADGRPGVWLGCEHTDWCS
SGPCDHGGSCLDLWTTFHCDCPRPYEGPTCSQEPLAWTFGLGGSHSMASFLLRDAPGPNL
TLSFVLRTREASGFLLQMTNGSLATYTVFLARGEIHVETTSTSVVTYPGRVDDGHRHLVT
LSLGSGQLQGTPLGPSYEVHVGGLTLPAWAEPWGGNFKGCLQDIRLNSLRLDFLPLLHPG
NWTGSGEVYEGQASNLTLGCVSEDTCRLEPCHNGGTCTVTWNDFICSCPDNFTGPTCAER
LWCQDQPCPPPTTCVEVPDGYVCLANATFQDQPPAVFTSYNLSAKVGFSSLSLAFRTRDP
EAVLLQAAGEGASLGVAIHNNTLSVSIRSGNSIEGATFRGVGPVSDGAWHWLTLTMEEPE
ASVSRWLLQLDGAQNTTLWGQAGSLDFLRHRVPVVLAENFTGCLGRVSIGGLDLPFVRLT
KPLPQPEQFLLDSGGDIDLGCRGGPVCSVEPCLHGGTCQDLFNAFSCSCGDGWEGPRCEV
DVDECSSAPCVHGHCGNLPGGYQCHCTPGYTGRDCETNVDDCIQHACLHGATCVDGTLGY
SCQCPHDFSGPQCQWPFPPDECGQNFTCLNGGHCYDGPWGANCTCPMGYTGLRCQIRIPE
CEPNPCQNGGTCQAAGSEVECICTSSFGGRRCDVAKGPPTILFPFPLIEVVVPVACGCLL
LLLIGLLSGVLAARKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences F6X3Y3
XP_007474690.1.35504 ENSMODP00000024632 ENSMODP00000024632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]