SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024646 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024646
Domain Number 1 Region: 84-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-27
Family Pentraxin (pentaxin) 0.001
Further Details:      
 
Domain Number 2 Region: 594-881
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000011
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024646   Gene: ENSMODG00000019744   Transcript: ENSMODT00000025082
Sequence length 884
Comment pep:novel chromosome:BROADO5:1:418817818:418875264:1 gene:ENSMODG00000019744 transcript:ENSMODT00000025082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKASPEAVETSGGVYEVKRSQQLDWWHAYTFCDQRFAQLTLELPHEALPELLQGQVQGPI
WVGQKTALLQRPQQRRECSLFVDLVFEMQTATKYARLLVDFPMLTAITVCAHIQWNSAVD
KVGTIFSYAAPAFANELQLRGFAAHNGLVHLALVVHGYHSPYLPVFSADEKWHHICATWE
ERSGHWALVADGKLQAGAQSLSPAQPLAPGGVFVIGQDQDSLGGGFKEEEAFGGNITSLY
VWARVLGPEQLDMARVCETPEDGLLFGWDRWTLEIEPTVHEVVLPFTCPVALEECPTLDA
GSGTLSSERCLQSLPFLCYYRPEAYQRLKEIQETSDGEFISRVNALANATMLSRDIFQED
IGSLSVPEATRFLGILEQTLAAEETPLQPADLLAVVSFLKRVVAIGVRDQDPYWQQEHLS
QSFLAVVGLLLEEQTKAQWLEMKEIIRSPMVLVESVERLAISLSLLLTSERSNISIQKGS
IGLSKVTVINTWFAYSALQHTLGWEGQESDKVLTQDGSKADERQKYLSTQVGSAIISSTI
LGHLQEISTAVHYHLLHQAQVRWSGWHPCPEGAGGSWSTKGCSVIARHQESTSCFCNHST
NFAILLQVYDLQRSSEEESVLKTLSFIGCGVSFCALITTFILFLAVGLPQSERTTVHKNL
IFALAAAEALLMFSEWAKAKKVMCMVLTALLHLFFMAAFTWMLVEGLLLWSKVVAVNMRE
GQRMKFYYVIGWGLPVVIVGITLASSFDGYMADHHCWLSLRNGVIWAFAGPVLFVLTVNT
FILFRVVIITVSSARRRSRMLSPQHSLERQIGVQIWATVKPVLVLLPVLGLTWLGSMLAH
LSMAWAYVSIILNSFQGLYIFLVYAVYNSEVRQAIQRMKEKKKA
Download sequence
Identical sequences F6WNS4
ENSMODP00000024646 13616.ENSMODP00000024646 ENSMODP00000024646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]