SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024670 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024670
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily DEATH domain 1.29e-25
Family DEATH effector domain, DED 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024670   Gene: ENSMODG00000019766   Transcript: ENSMODT00000025106
Sequence length 114
Comment pep:novel chromosome:BROADO5:Un:19210521:19338857:-1 gene:ENSMODG00000019766 transcript:ENSMODT00000025106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDPFLLALHRISCNLSKKELEDMKFFCKKDIGKKKLNEVEQAIQLFSLLMQQNLLSA
NNTAFLTSVLRSLKRDDLIQELAKAAGSQPGSGAPLDPAVEEQLEVYRQQLPET
Download sequence
Identical sequences H9H7F7
ENSMODP00000024670 ENSMODP00000024670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]