SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024675 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024675
Domain Number 1 Region: 309-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-40
Family SPRY domain 0.0000909
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 94-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024675   Gene: ENSMODG00000022820   Transcript: ENSMODT00000025111
Sequence length 482
Comment pep:novel chromosome:BROADO5:Un:16593547:16620816:1 gene:ENSMODG00000022820 transcript:ENSMODT00000025111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARKLIESLKAELTCSICLGYFTDPVTALKCGHNFCKDCLLQCNEQADATLTCPECRAV
IRYSDIVPNENLQNLSITGKTLRQHLLQSPALLTTCDQHGKKEKLFCEQDQKLICDSCLL
TQEHKDHQVLPLQMAVDKCKKKLQETRNMLQEKEEEYKKAMDELIELDETLKVSFFLSYY
FQQLIRSEYKKMHEFLCNEEEINMEELTQEITDNQERFAKMEYSKHVQHFQRILEIKESL
DEAPLEILQGTPRSPHIVSNVFPKFPMYFLMSQSLRLFRMREIKCCGGRRGYFKLQHLTP
KTNYSFSPSIVNISLDPEIDSLHLIVPEYLKYKRDPQDQSDKEEKLDYFVTVLGIETFSS
GKHYWEVDVEGQTKWVLGICEESVSKNKNVSILSKDVRVMIGSKVNDGILFWSPQCCFVS
IPTPKVGVFLNYEEGEVSFYDIEDKSNLFSFPNSAFQGPVRPFFSTSLAIKEVPLNHPLP
TP
Download sequence
Identical sequences H9H7G0
ENSMODP00000024675 ENSMODP00000024675 13616.ENSMODP00000024675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]