SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024735 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024735
Domain Number 1 Region: 280-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-50
Family SPRY domain 0.0000842
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000101
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024735   Gene: ENSMODG00000019818   Transcript: ENSMODT00000025172
Sequence length 465
Comment pep:novel chromosome:BROADO5:1:424156127:424157524:1 gene:ENSMODG00000019818 transcript:ENSMODT00000025172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAKLAENLKEELTCPVYMDYFSHPVNLGCGHSFCQPCLLRTWREVDKSCPCPECRRAF
QIKDLESNHCLGKLSSLARNIRPYLLQLRMERAICERHQEEQKLFCEEDQTLHCVSCFES
QEHSRHTVHLIEMAAEDSRDKLQKTLDLLWKEVEMIQNMLTEERQKMETWNEQADAWRES
IRAEYKRLYEFLKCEEKWHLQNLSRDESKNIKNLRESETRLSQHLQSLKEIIIDLEQNGQ
KPDLQLLKVGGGTLKRIKSLLSHRPEATIIQVSMAPITGIWEMMKHFRVNVTLDPESACP
YLIVSENMKTVTHRGYQQYIPVAPHQFEDSIILGAQVFTFGMHYWEVNVGESRKWAVGVC
KASLSRNASVSLSTGDVFLLTHFQKRNTYSMMTTPFCIEYHSNSPIQKVGIFLGYDQGSI
SFYDALKNSLIFRFPAFPFSDPLKPIFCPCPPRGEENGIPMTIDP
Download sequence
Identical sequences F6STE0
ENSMODP00000024735 ENSMODP00000024735 13616.ENSMODP00000024735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]