SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024806 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024806
Domain Number 1 Region: 42-263
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.08e-57
Family Ankyrin repeat 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024806
Domain Number - Region: 810-916
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00217
Family Myosin rod fragments 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024806   Gene: ENSMODG00000019880   Transcript: ENSMODT00000025246
Sequence length 1238
Comment pep:novel chromosome:BROADO5:Un:5445307:5715017:1 gene:ENSMODG00000019880 transcript:ENSMODT00000025246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFGTRTEPETCGPTSPRRDVGINGATAKDGYRIRKKFLGKLHRAALSGDCRKIQWLLL
AKGKDINKVDDLNRTALHLACAAGYPDVVSFLVERHCKLDICDSNHRTPLMKAVQCQQEE
CVSILLLHGADPNMVDESSSSALHYAAAGENLRIVERLLESKANMEARDKLGLTPLLLAV
KNHHEAMVDLFLKNGANVNAKDNSKRTALMMAISNKFNPTSLVQLILQYDVDLSCEDDFG
WTIRDYVRISNTERLHESILPHKKKMNFEEKKQPEADMPLKTIREQIRREEKLSSKEVEK
KQSLEVAEQNQAREPRPGGNNLTQVNAKFRHFASRFPLKKEKEKQSRAGMPLKTIREQIR
RKEKLSSKEVEKKQSLEEPEQSQTTKLRLGENNLTQKKQSLEVAEQSQTTKLRLGENNLT
QQSKAGMPLKTIREQIRRKEKLSSKEVEKKQSLEKEKQPKAGMFFKTIREHLRRKEKLYS
EGVEMKQSYQLTVQSLDREPRPGGNNLKQIPDYHEKEKPVLQKNNLLLDEIGVFLLAGDT
GKIEKREKESRHIKENEVSKEKTDELQKKLKLSEETLRTKLSEANKQLNFLMIKNRKLTS
KWKKEKQKRARVGKDKQSCHLCSAIPDPKQCQTSKQDLAYAFQQERDEWLRIKDQLNYDL
SRERDRNDFLAQQLEEADSEVNSLQNQLIHLHCSYREKALILESTERALHQAQFHIKELK
RINNIQNEKQQEYTAKEECYQGKLPEIHSENMVLQQQLENAPKRVIIKKKVVKDVQVNFS
DPFAKVHADREKQVLLVEERNKELIDDCNHSREQGCTYEKEQKEREGTIKELQQQLADAL
KRQSTLEVFLEVIFCYIHDLEDKKQQLQKETEEIKSKLRESEGRHPKAEPWTNDLEDGEQ
KLEMENGRLEATAKELLGKMEEMEENLLDPKWLDPERGKGKTLVELKQSLVASLDDQRKR
NEEVEQDIGRPRKKKLEEDDKGDLASQEALKQACSQVEDAQMNTLRNQKEELAQQVEAAS
SKCIQLEWTIQGLRQELLSKESLEEKNGKLEKEKSQLEEEIANLKHRFKMTMLEHRQVEQ
YKSEVDEQATQEIIGKLRTIKLFLQTQAAFQNNTEQLGENHQAPRGNEMEWRMKYMEAEL
STLRSSYQDAEEQLERNTQLYFKELKANESLSKELDRANRRLLKVSAKLRNERQRNETLR
ASFTASPVLEPPPTEPPNSSSLLNGGLIPRGNRTCFEQ
Download sequence
Identical sequences H9H7J4
ENSMODP00000024806 ENSMODP00000024806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]