SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025280 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025280
Domain Number 1 Region: 1502-1589,1617-1677
Classification Level Classification E-value
Superfamily CalX-like 1.96e-31
Family CalX-beta domain 0.00066
Further Details:      
 
Domain Number 2 Region: 780-928
Classification Level Classification E-value
Superfamily CalX-like 1.57e-30
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 3 Region: 3705-3849
Classification Level Classification E-value
Superfamily CalX-like 3.01e-30
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 4 Region: 2737-2865
Classification Level Classification E-value
Superfamily CalX-like 8.37e-30
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 5 Region: 1894-2024
Classification Level Classification E-value
Superfamily CalX-like 2.75e-28
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 6 Region: 2382-2492
Classification Level Classification E-value
Superfamily CalX-like 3.53e-27
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 7 Region: 2030-2161
Classification Level Classification E-value
Superfamily CalX-like 4.97e-27
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 8 Region: 4180-4329
Classification Level Classification E-value
Superfamily CalX-like 1.16e-26
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 9 Region: 4044-4186
Classification Level Classification E-value
Superfamily CalX-like 1.96e-26
Family CalX-beta domain 0.00074
Further Details:      
 
Domain Number 10 Region: 1075-1274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-26
Family Trypanosoma sialidase, C-terminal domain 0.03
Further Details:      
 
Domain Number 11 Region: 907-1058
Classification Level Classification E-value
Superfamily CalX-like 3.14e-23
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 12 Region: 183-328
Classification Level Classification E-value
Superfamily CalX-like 3.01e-22
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 13 Region: 1765-1904
Classification Level Classification E-value
Superfamily CalX-like 6.93e-22
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 14 Region: 4989-5167
Classification Level Classification E-value
Superfamily CalX-like 2.88e-21
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 15 Region: 551-704
Classification Level Classification E-value
Superfamily CalX-like 4.45e-21
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 16 Region: 3447-3591
Classification Level Classification E-value
Superfamily CalX-like 1.83e-20
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 17 Region: 4439-4576
Classification Level Classification E-value
Superfamily CalX-like 2.09e-20
Family CalX-beta domain 0.0056
Further Details:      
 
Domain Number 18 Region: 3359-3444
Classification Level Classification E-value
Superfamily CalX-like 2.09e-20
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 19 Region: 1657-1762
Classification Level Classification E-value
Superfamily CalX-like 3.66e-20
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 20 Region: 3827-3967
Classification Level Classification E-value
Superfamily CalX-like 1.03e-19
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 21 Region: 4780-4907
Classification Level Classification E-value
Superfamily CalX-like 2.22e-19
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 22 Region: 2599-2734
Classification Level Classification E-value
Superfamily CalX-like 2.22e-19
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 23 Region: 1362-1489
Classification Level Classification E-value
Superfamily CalX-like 3.14e-19
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 24 Region: 2876-2982
Classification Level Classification E-value
Superfamily CalX-like 6.15e-19
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 25 Region: 676-780
Classification Level Classification E-value
Superfamily CalX-like 8.89e-19
Family CalX-beta domain 0.0059
Further Details:      
 
Domain Number 26 Region: 2480-2615
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0033
Further Details:      
 
Domain Number 27 Region: 2125-2170,2272-2350
Classification Level Classification E-value
Superfamily CalX-like 3.79e-18
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 28 Region: 41-176
Classification Level Classification E-value
Superfamily CalX-like 6.41e-18
Family CalX-beta domain 0.0035
Further Details:      
 
Domain Number 29 Region: 437-581
Classification Level Classification E-value
Superfamily CalX-like 4.97e-17
Family CalX-beta domain 0.0081
Further Details:      
 
Domain Number 30 Region: 3949-4053
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000034
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 31 Region: 1275-1358
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000116
Family CalX-beta domain 0.0079
Further Details:      
 
Domain Number 32 Region: 5265-5412
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000127
Family CalX-beta domain 0.005
Further Details:      
 
Domain Number 33 Region: 3552-3687
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000124
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 34 Region: 4315-4427
Classification Level Classification E-value
Superfamily CalX-like 0.00000000353
Family CalX-beta domain 0.0055
Further Details:      
 
Domain Number 35 Region: 5159-5280
Classification Level Classification E-value
Superfamily CalX-like 0.0000000157
Family CalX-beta domain 0.016
Further Details:      
 
Domain Number 36 Region: 2-68
Classification Level Classification E-value
Superfamily CalX-like 0.000000157
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number 37 Region: 4540-4645
Classification Level Classification E-value
Superfamily CalX-like 0.000000471
Family CalX-beta domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025280
Domain Number - Region: 4667-4761
Classification Level Classification E-value
Superfamily CalX-like 0.000144
Family CalX-beta domain 0.0073
Further Details:      
 
Domain Number - Region: 293-406
Classification Level Classification E-value
Superfamily CalX-like 0.000458
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number - Region: 2987-3057
Classification Level Classification E-value
Superfamily CalX-like 0.00131
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025280   Gene: ENSMODG00000020196   Transcript: ENSMODT00000025729
Sequence length 6077
Comment pep:novel chromosome:BROADO5:3:212317796:213021245:-1 gene:ENSMODG00000020196 transcript:ENSMODT00000025729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIPENDELFLVQLKSIEGGAEINTTRNSVQIVIQKNDSPIRFTQNSYLVPEEADILKIPV
VRGKNESGYLIGSDEYQVSINYAVVTGNSTVHAEQNVDFIDLQPNTTIIFPPFVHESYLK
FQIIDDAIPEIAESFLIVLLKDTLQGDAVLLSPSTVQVTIKANDKPYGVLSFNSVLFEQT
VIIDEDQVSRFEEITVVRNGGTHGDISVRWVMTRNSSDTSPVSADIMPSSGILHFAQGQM
IASIPLTIVNDDIPEEAEAYLIQILPHTIQGGAEVSEPAELLFYIQDSDDVYGLIKFYPL
EDQKIESSPGERYLSLNFARQGGTKGNVKMIFSAFYIPAGSVDPLRAKDGILNVSRRSSL
IFPEWKTQVATKLPIRNDAFLQNGAHFLVQLETVELVNIIPPIPPLSPRFGDVRNISLRV
TPDIANGEIGFLSNLPIILHEPEDSLAEMVYIPLHRDGTDGQAIVFWSLKPSGSDSELVT
PDDIGPFNGSVVFLSGQSDTMINITVKADDIPEMNETVTLSLDRVSVENQVLKSGYTSRD
LIILENDDPGGVFEFSPASRGPHVINEGESVELHIIRSRGALVKQFLHYRVEPRDSNEFY
GNTGILEFKPGEREIVITLLSRLDGIPELDEHYSVILSSHGERESKLGSITVVNITILKN
DDPHGIIEFVSDGLVVTINESKGEDVFSAVYEIIRKRGNFGNVSVSWVISPNSTEDVFPV
QDTVFFGDQDFSKNITIYSLPDEIPEEMEIFTITLFNATGGAKVGNITTATLQIRRNDDP
IYFAEPRVVWIKEGGVANFTVLRNGSLDFACTVQYATRDGEATAKEGDFVPVEKGETLFF
DVRRREQSISIFVNEDDVPETDESFYVILFNSTGDTVVYNYGIATVIIEANDDPNGIFSL
EPVDKAVEEGKTNVFWILRHRGHFGNVSLMWQLFENDSALQPRQEFYETSGTVIFMDGEV
SKPITLHAIPDKIPEFNEFYILKLVNISGGSPGPGGQLAETNLHVTVMIPFNDDPFGVFV
LDPECQEREVAEDVLSEDDMSYITNFTVLRQQGTFGDVRVGWEILSSEFTAGLPPMMDIL
LIAFFPNSVQSQPHRRRHHSGTDALYFSGMEDAFGTISSKYHPTRNNTIANFTFSAWVIP
NANTNGFIVEKDDGNGTMYYGVRIQTNASYVTLMLHYTTLGSNITYVAKTTAMKYLEENI
WLHLLIILDDSIIEFYLDGNPMPRGLKSLKGEAIADGPGIMRVGAGMNGNDRFTGLMQDV
RLYERKLTSEEIYELHATPAKNDLHPISGYLEYRQGETNKSFIVSAKDDNEEEGEELFIL
KLVSVHGGARISKENITARLTIQKSDNANGLFGFTGACIPEIAEEGSTISCVIERTRGAL
DYVHVSYTISQIDSTGINYNVDDFANASGTITFLPWQRSEVLNLYVIDDDIPELNEYFRV
TLVSAIPGDGKIGSTPTSGASIDVEKETTDITIKASDHPYGLLQFSVEMPPRPDDKMTLP
AASIPHVTVKEEDGEVKLLVVRAQGLLGRVMVEYRTISLTAFSPDDYQDTSGILEFQPGE
RYKYITVNITDNSIPELEKSFKVELFNSEGGVAELFRIDGSGSGDGDEEFFLPTIHKRAS
LGIASQIIVTIEASDDAHGIFEFSPESLYVSGTEPEDGQNPVTLQVVRSHGALSQVTLHW
NIPSDVSGDLAFTSGNVTFGIGQLSANITVEILPDEIPELDKAFSILIINVSSGCLGVHT
NATLTVLASDDPYGIFIFSEENRPIKVEEANQNVTLTIIRLKGLMGTVMVTYATMDDTVK
PPFFPSNIARATRGKDYIPVSGFATFRANMSETIVIIPILDDDEPERSESVFIELINVTL
IEKVQDRPIPNSPRLGSKVDTIAHLIILANDDAFGTLQLSAPIVRVAENHVGPIINVTRT
GGVFADVSVKFKAVPITAIAGEDYSIASSDVVLLEGETSKAVPIYIINDNYPELEESFLV
QLLNETTGGAKLGALTEAIIIIEASDDPYGLFVFQTTKIIVEEPEVNSVKVNLPIIRNSG
TLGNVTVQWVATINGELATGDLRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEIIQVQL
THASGGGTIGLDRVANIIVPANDNPYGTVAFSQSVYRVQEPLEKSSCVNITVRRSGGRFG
QLLLYYSTADIDVVALAMEEGQDVLSFYESPAQGVPDQLGRTWVNVSATVNPQHMCATLC
LKEHACLAFSTSFSSEIPQCFWITTWSSLIVNSSEFWTYRKNMTRVAALFSRQAVAGSDY
EPVIRQWAIMLEGDEFANLTVSILPDDFPEMDESFTISLLEVELMNISASPENQPTIGQP
NTSTVVIMLNGDAFGVFKIYSINPNTSKDGQYVEVQEQPLALVHLSIERIGGSLGQVTVE
WRVVGGTATEGLDFIGEGDILTFAEGETKKTVTLTILDDSEPEDDENIIVSLVYTEGGSR
ILPSSDTVTVNILANDHVAGIVSFHTSSRSVIGHEGENLEFHVIRTPPGRGNVTVNWKII
GQHLEHNFANFSGEIFFLEGSLNQTFLVHLLDDDIPEEKEEYQIILYNVRTRGVSSTGMA
IIDSQGYEAVLTVEASDEPHGVLNFAPSSRFVLVQEANLTIQLFINREFGSLGIINVTYA
TVPGMLSLKNQTDGNLAEPGVDFISVVGYLILREGETSAAINITILEDDIPELEEYFLVN
LTSVELIMAPQTSFPPRLDSEGLTAQIIIDANDGARGKIEWQNTRLEVRESQGSLTLEAH
RGGGSLGHVSLFVYAQNLEAQLGMDYNFTPMILHFANGERYKNVEITIFDDEIPEGDENF
LVILTNPSPGLELGENTTALITILANDDGPGVLSFNNSEHFFLREPAALYLQESVAVLYI
VREPAQGLFGTVTVQFIVTEMNSSKPSEDLTPSKGYVVLEEGVRFKTLHISAILDAEPEM
DEHFVCTLFNPTGGARLGTPIQTLITILQNQAPLGLFSIWAVENRDTTITTEEANRTIYL
NVSRSNGLNLTVSVEWETVSETAFGMRGMNNVLSVFQSFDPASSWCFFTLGESVYAIMLR
TSSQQLSSLYRWQGIFVTVEDINVQNPKSCETFSIHGSPYLVITHGEKEGEKPSRNSIYT
VTSELKLFLEQTILVPESSQVKHFTSTNQHFLIIASQRDDSELTQVFRWVSGSFVLHQKL
PIHGVLSMTLFPRGGSMFLAVSPSDPGLNSILFRWSGSEFSRFQEVSVIGTVHVEALTSG
DDIYLIFAKGMFLGGKSAIDIFIWETGQSSLRYFQSLDFGAVNRIHSFTPTSGIVHILLV
GKAESALYCWSSELNQFSFVLGAPSANDAASVTVKSLNSSKNLIVLAGALHSQVYELSYI
SEQSDFIPSSGELIFTPGSREAIIAVNILDDIIPEEEESFRVQLKNPKGGAEIGINHYVK
IVIPSNDDAYGVIAFAQNSLYKQVEEMEQDNLITLNVERLKGTYGRITVEWVATGSISDI
FPTSGVISFSEGQALLTITLSVLADDIPELSEIVVITLIHVTTEGIQDPARGATIDPRRN
KAVITTLPNDCPYGVVGWHAESLFVTVFEPEENATIVLLKIVREQGLLGDVAVHLVAEPN
LSLHPDNRAIENEDYVLPEKVMIMQENEEITYAKVLILPDDVPELEEGFIINITDVHLVN
SEFSGGQPSVKRPGLEIAEIVIAENDDTRGVFQFSIDRDVNGVIIVHEVPPPLNVLKLTV
VRLAGSFGLINVYWKAIPGNASLEDFTPSHGILTFEDKQVSEVLEITVIDDTEIESLETF
SIILFSVTGGARLGVDTEVTIVIPPNDSPLGIFGFEERTVTVPEALSADDPDPYITLTVT
RSQGGKGAVQLLWVLEEAARDDLSPLNGTLHFEENEFKKAIILHAHQDTFLEGDKSFIIQ
LLSLGDVEISPVNGRAAIVIQGEKSISGEIGIAPLSRNVFIGEPSAKYNGTALISLVRSP
GTFGEVTIYWSIFPPLAEEFAEISGELTMRNGQSVATVVIQALDDNIPEEKCLYEFQLTG
ISEGGSLKESSRTANITMVASDFPYGWFVLSPKLLQVSEEAKKVNITVVRSGGHLGQVKL
WYETVSGTAEAGLDFIPAVGEFLFEPKEKAKSIHIEIIDDDLPEGPEEFSLALTKVELQG
RGYDFTVRENGLQIDQPPEIGNISTIRIIIMKNDNVEGIIEFDPRYSAFTVEEDVGMLMI
PVVRLHGVYGNVTADFISQSISALLHVDYRVHGNSIIFHHGQNLSFINVSITDDDESEFE
EQFEILLTEVTGGAVLGRHLVSRITIAQSDSPHGLLRFLNQSKMTIANPSSTLILSLVLQ
RTGGLLGEIKIDWNILGPNSQEVLPPLNSDIGEPVNGSFSFADGEGGLRTITLTILPHED
VEVQEIFIVELHVVKGEAKLDQKARNVFLVIQKFGDPNGIVQFAPESLSKKNYIEPSTLE
GPLSIVFYVKRVQGVTGNITVYWELSSEFDITGDFLTTKGFFMIADGKSEASFDIQLLPD
DVPEIDEDYIIQLVSVDGGAEVDKEKSFTSFSVPANDDPHGVFALYARWQSIVVEQSLNR
YIQINVTRLAGTFGDVAVGYRILPNSPDQPIVTERTEGHLIVKGGTSYKVDTVPIMNQVF
LLLGSDLTLELLNVIHVGGQFYGMPKILEEAKSTLLAIPEEAANSEIGFDSTAFQLTNIN
SGTSLAIISRRGTYGSVTVTWNSRYPSEVEIPEFVDIGDITPKFGTLTFSHHEQSKEVLL
STLPRPGRPEAFIIHLSTVQSSAPGGARLRSGFTVAEIEPMGIFQFSMISRDVIISEDAQ
RVRLNVQRLFGFHGDLTKVTYQTTAGSAKPLEDFGPVQNGELLFKKLQTDIDFEINIVDD
QLPEMTKVFYVNLTSVEMKGWQQLDAHWKPRLNPEFSVAVITILDNDGTSVMDAALPLTT
PAFPKATEAVVASHTVVTPPEAPKTTAIPQTTEMVTFVPEATGIVLLTNGAIVPEKPDVV
TVTDVSMKGIFSLGPPIIYVEEDMKENILTTVEILVRRTSGFNGNVSIAVKTFGGISAQR
ETGEFPFQDAYGISNLTWANEGEDFIEQSFILTFLDGERENKIYVQILDDDEPEGQEFFY
VFLTNPQGGAQIIKGRDDTGFAAFATIIIKGSDVQNGIVGFTEDSQSGLDLDGDSAKRNV
YLTVTRQPNRAFEDVKIFWRATFNKTAVVLERAGVDLREMLLSVSGTTTCVAGQMKCLIS
IELQPNKKSQFEMDFFVELYETSIGATINSSTRFAQIKILKSDGPYSLVYFSVGSRLAVA
NKKATLISLQVARDFSTTLMVCVNFSTQELKIAETVGRTLISPALSGKDFIKSEGKLIFE
PGQRNAVVDVILTPETESLNPYPKRFQVVLSDPIGGARIDKMYGTANVTIVTDTDSQSFW
GLADQLHQPLDEDILMRVLHNLNLKVATENTDEQLSAVMHLIDKVTVEGKKQVFSVRSRN
LFYDILCTLINPRRKDTRGFSHFAEVTEKFAFSLLTDVSCGSPGEKSKTILDTCPYLSIL
ALHWYPQQINGHKFEGKERDYIQVPERLLDVPDASLVAGEKKCKLVQFTEYSSQQWFITG
NSVLALNNKVLSLSVKGQSSYPLTDNNEVLYRIYATEHLIVPQKSLCLLWNQAAAGWLSD
SQFCKVVDVTSDYVECACSHMSIYAVSAQTDSLSSYNEAFFSSGFICVSGLSLAILSHIF
CARYSMFAAKLLTHMMAASLGTQIAFLASAYASQQLTEESCSALAAVMHYLYLCQFNWML
VQSVNFWYVLVMNDEHTERRYLLFFILSWGLPAFVVILLLIVLRGIYHQNISQIYGLIHG
DLCFIPNVYAALFTAALIPLMCLVVVFVVFIHAYQVKPQWKAYDDIFRGRTNAAEIPLVL
YLFALISITWLWGGLHMAYRHLWMLVLFVIFNSLQGLYVFVVYFILHNQMCCPMKASYTV
EMNGHPGPGSAFFTTGSGMPPAGGEISKSTQNLISAMEEVPADWERASLRQAGQTSPDFK
PSPQNGASFPASGGYGQGSLIADEESQEFDDLIFALKTGAGLSASDNESGQGSQEGGTMT
DSQIVELRRIPIADTHL
Download sequence
Identical sequences F7FXQ0
13616.ENSMODP00000025280 ENSMODP00000025280 ENSMODP00000025280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]