SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025323 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025323
Domain Number 1 Region: 1-419
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-93
Family L-arabinose binding protein-like 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025323
Domain Number - Region: 427-473
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00506
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025323   Gene: ENSMODG00000020245   Transcript: ENSMODT00000025773
Sequence length 756
Comment pep:known chromosome:BROADO5:5:297174269:297189462:-1 gene:ENSMODG00000020245 transcript:ENSMODT00000025773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQHFLTVQFAVDEINKDPHLLPNVTLGYQFLNNFHLSHLAVESSLIWLSGKGPTIPNYSC
GGQHKSMVVIGGMSSKLSMAMATLLGLYKVAQLSYGSFDLLLSDEVLYPYVYQLGSREST
LHLAAVQLMLYFGWTWVGLVISDDPTGEQFFRNLKEEMALNGICLAFTERAPELFQEDYE
VIKLMSRILGSSSNVIFIYGTTDSLGEISELFHDHKFYGKMLITSTSWDFSADSRNARMS
NFHGTLILSHLERVIPGFTDFLRNVHPRANPEDIFTKSYLEVVFECTLSEISSIGIIYEQ
CDENISFALVPPIYLNNLIIGRNSNIYNGIYLFACALHHMLQTEAKDVSEFAANPLLSWK
VIFLLHYDLCGDGTSMTAETYEVLNFKSFPDNISVEVKVGEVIPQEKVLSINEEDIDWPE
DFPQIPSSKCSEACGPGFRKQLREGQPICCFDCTLCPDGKFSNKTDAEECMQCPEDQYPS
KEKDRCLPRTVTYLAYEETLGMILTSAAFCFSILTTFVLGVFVMYRDTPIVKANNRSLSY
ILLTSLTLCFLSSLLFIGRPTPAICVLRQTTFAIVFTVAIASILAKTITVVVAFRATKPG
SQLRRWLRPAVSHSLIFLCTLIQMCLCGIWLGTYPPFLEMDIYSEASFIVIQCNEGSLVT
FYCVLGYMGFLALVSFTLAFLARKLPDTFNEAKYLTFSMLVFCSVWISFLPAYQSTKGKA
MVAMEIFSIMVSSAGILICIFAPKCYVILLRSDRNT
Download sequence
Identical sequences F7D3Y1
ENSMODP00000025323 ENSMODP00000025323 13616.ENSMODP00000025323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]