SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025324 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025324
Domain Number 1 Region: 206-366
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.98e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000184
Further Details:      
 
Domain Number 2 Region: 44-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000349
Further Details:      
 
Domain Number 3 Region: 8-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000884
Family EGF-type module 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025324   Gene: ENSMODG00000020246   Transcript: ENSMODT00000025774
Sequence length 368
Comment pep:novel chromosome:BROADO5:3:222471775:223010927:1 gene:ENSMODG00000020246 transcript:ENSMODT00000025774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSTVSTVSFCESEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQ
QITASSTHRALFGLQKWYPYYARLNKKGLVNAWTAAENDRWPWIQINLQRKMRVTGVITQ
GAKRIGSPEYIKSYKIAYSNDGKSWAMYKVKGSNEDMVFRGNVDNNTPYANSFTPPIKSQ
YVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWE
PRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAY
SNDGEHWTIYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSE
LLGCTEED
Download sequence
Identical sequences F7D3X7
ENSMODP00000025324 ENSMODP00000025324 13616.ENSMODP00000025324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]