SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025332 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025332
Domain Number 1 Region: 3190-3347
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-41
Family C-type lectin domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 144-258
Classification Level Classification E-value
Superfamily C-type lectin-like 2.12e-40
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 253-358
Classification Level Classification E-value
Superfamily C-type lectin-like 2.49e-29
Family Link domain 0.0033
Further Details:      
 
Domain Number 4 Region: 26-148
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000173
Family V set domains (antibody variable domain-like) 0.016
Further Details:      
 
Domain Number 5 Region: 3348-3406
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000111
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 3144-3185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000679
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025332   Gene: ENSMODG00000020252   Transcript: ENSMODT00000025782
Sequence length 3450
Comment pep:novel chromosome:BROADO5:3:223616244:223756358:-1 gene:ENSMODG00000020252 transcript:ENSMODT00000025782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSIKSVLWMYSTLVVTHAVRQVTVEKSPPVKGFLSGKVSLPCHFSTMPTLPPSYNTTS
EFLRIKWSKIEEDKSGKDLKETTVLVAQNGNIKIGQGYKGRVSVPTHPEDVGDASLTMVK
LRASDAGLYRCDVMYGIEDTQDTVSLAVDGVVFHYRAATSRYTLNFEKAQKACLDNGAVI
ANPEQLKAAYEDGFEQCDAGWLSDQTVRYPIRAPRAGCYGDMMGKEGVRTYGFRAPHETY
DVYCYVDHLEGDVFHVTGPNKLTFEEAEEECANQDARLATVGELHAAWRNGYDKCDYGWL
SDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPLPDSKFDAYCYKPKQNISETTTIQ
LNIPVETEPPNLSKEPQIIPIQATPGIPLITELPVTQSNIPPMGEIVNIEQKVTVFPYGE
TKKKFEEATIQPEATVGSSTAGSRDSLWYTEYPLSVSGPLEKSDTSEIEEGISLSQPTSS
ENGVVHNATELWEKNTEDTQTQEVITQTEEIEVGPLVTYLETSGHTPVKESSTHESLTLS
TKITMGNKIEKDSTNDFISGSGPTDLYEFPTREDEEQTHTIKPDQNSFPFSQIPEVVTVS
KISEESNLTLTEYTVSIPTVTGTLTVTLPAKEGSSTDSWEETQTSGRITEDISGQRVSMP
LPLENQTEVTFFAPSPDLTSPQGLVEGTPTLIYPDQQTEDGEREQVAKPEATTVHHAIEE
TEKSMTKDPFYGGIKEEEFSGMKPFPSSPEKTDVTESTDEMTKYFDASMTTTVRTKISVE
KDIEGKFISTPVNLETVGPPITTKMEENKTKVHSTGSTLNLEVVTVSKWPLHEDNITSKL
LTSTEHMGTTILPTALLTTEKVEQISRFEEPGRDKTSEHFETGKTFPVTTDVTQRPMVEF
TEELREDEEEFTESSYSIPKTGIETEPTAKYSPTEEVPSSTGTDRHVVDKTKEGSAFEER
LELDTPEPVTTVPQFTQTIYGEVPVFVSHSSSTLEPPAHVDATQTVLLIPKPEWEVFTPS
VSSEGKATQDVHLVDQTPFEATHSLETIQTISKTIQLTPVSEKEKPTEYPGFSTGFVATT
SSELLITPPAEDTDEGDFDGSAYPTSEDELVTDSKQVTVFKTTAGSREHSASYPHYISVT
EHKVKTEVEIVTAATTSEGHLSPRPEQEPERKASSPSTWESRTPLSSFTTEGVPQSTQEM
TAREKEQTSQDYTELGSGLLERPKGTETVALTAVPTVKITVPSDATTLFSPLDKIHSTST
SKSFVTKDKPPIIDGEPGEETISDLVIIDESTYHSTPTPLEDLVTKELETDIDREYFTTS
SASSIAQTTRQPATEEGKDALVSQEVSTSEPQARETIHPDINVFIITVTGNKTGRMSDLS
IIDHPIDSNSKEDEPCSEESDEQPDFLTLLPGIFEITPYFVDEEDDDCENSTDVTTTPSV
QYINGKHLVTAIPKDPETAEARRGQFESVAPSPNFSHSETNPFDLSEIESSTISQPSESK
EILESFEITWKPDIYPETSEPFSSGESDIFPTDQMSGATGLNGKGSLEVAKPVIQIGSEH
PNHSEENNETTSSFPEESSGDSLVNQESQGVVFLRTTEVAFGEATGHDSIITSAPITVSD
SVSVDILSEERSSVLMGNQQPDTISSLESWEDTTSRHTVEFLGNPPLVLIPEGSGFVEED
SNKTSTVVASLLQHTPTIEIPLKGVPLDTSQVIPTESFFGVSTSASNPVWEESSVDILTP
KFETETEVPRSTSISLKNRINTSVDGKNLDDERENTSIMATSIKESSIQPTVEQLIFTFE
SRNSDEVKPTDSDSSATENRSTQFEGNTNKSDLIPTQPLFSKKLEEENIDKSTTIQHMVP
ESPTLPGVSSNSFLLEEGSGEVGSTMELTTEPLASLILKATKANERPTEYEAKEMTGTLP
SPITNAMPFEPTSSVLNSVPDVSDVGIVNKLARGNFSTDKMQETNYGTEINDTPTNFPLK
EVVTSASRKFSTAAHPVSEEEIAVVEGSGEKTLMESGNIIHFSTTTLARPESGTDSERPE
STVVSLPDHLPEKFTFIPEGSGEEPTKISSSIDHIPSRATEKTFSTDFLFAYSGSGDVDF
ITHSEERHIPSPSLVSEGSEMPVGKVEEEVNSTVSMSYSFTVTPANLALSVGHEVNTARL
GIENKIPIEEKVTEEKPFESGKSTLGKGVISDTEIFAESQPQTTDYSIQTTKETFIGIKE
PRPTEDISFFSTISTDLEEKSLSIFAPRIESTKESPSPFDGISVTESQISKTMGTKPTIK
EEENTKQSIFLIENEHIENNDPEGMRPSIQEFHTNPVFSGEGSGDDVFPSQSTVVFSFTG
IKENISILAPETHQPESSEPNLEPEENKKGTHGEVRYHDSQTNNASETSHTVANTWLFES
SRDNGDEETTLSSVTHSLKMEVSENEDKTFNGVEETQTNKQQAITGKLSQENPSQSETIE
GVTSTNIFFTRPSSVETAKVFVTSAPHIPVQSYENSGEGSGWLDGADSVHASQIVQTAVA
ITTVVPNSYEGNYSEFPRMEALVTSGLPASTLPTQTEQNESSQNLLGTQPNLRTSESSTS
HSPDGFKEFEVLTLKPERRKFTESIILDLDKEDSDLILLTTKSTAPETLPEITPDKNTII
DIDHTKTAYEDILRVQTETDPELQSVPYGSNEESMQVEEKEDAAFNLSFTEEKTEGSGDN
LWSRPTQAISNESAASEDGIRLGQDYVSKNSERFTTGIPISSMAAELGVLLPTVSSLAIP
SISSTISQDIKELKFEEKHVATESTLDDLFESSTLSDGQPVADQSEEISTLGYLEGTQSE
DDGKKFISPSFKPELSSGQEDELINHTEDVTIATIKFLDQNLTETPDIIEGSNPTEYMVK
PSDSASAEVYSQAPSSVATIHLADNASEYPEVIIPSSTSTTDSDADRISLEETFKEVNSN
VEATLWPLSEVSSHRIDLPFLASPGTGLAIEETETSAAEILVAEEETRSPEYSQTFTDEK
FSGETTKTSPGVDLPKGGTSLEATGDRNLEDALQGLLSTPTSANHGVVGGMLFQSGSQAT
ENPTTPFASIEINTEMQPVYNGIVNNQIPARTTNSEDQAISMEELNTEQITSSFLIPETS
NGTDFLIGTNEDSVEGTAVYLSGRDLCKTNPCLNGGTCYTRDTTYVCTCVPGYSGDQCEF
DFDECQSNPCRNGATCVDGFNTFTCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAH
RRTWDAAERECRLQGAHLTSILSHEEQLFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQ
YENWRPNQPDSFFSSGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAK
TFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWALPKITCMNPSTYQRTYSKKH
FKNSSSAKDNSINSPKHYHRWSSRWQDSRR
Download sequence
Identical sequences F7CK30
ENSMODP00000025332 ENSMODP00000025332 XP_007487407.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]