SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025358 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025358
Domain Number 1 Region: 6-315
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-63
Family L-arabinose binding protein-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025358
Domain Number - Region: 323-369
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0494
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025358   Gene: ENSMODG00000020272   Transcript: ENSMODT00000025808
Sequence length 660
Comment pep:novel chromosome:BROADO5:5:296506798:296526972:-1 gene:ENSMODG00000020272 transcript:ENSMODT00000025808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSRESTLHLAAVQLMLHFGWTWVGLVISDDLTGEQFFRHLKEEMAWNGLCLAFTEQVSE
KIKPEDDDIKFLARILGSSSNVIFIYGNTASLNVFSELLNSFALYGKMLVITASWDYSAH
STTEMMSNFHGTLIFSHFKGEIPGFTEFLKSVHPQANREDIFLKSYWEIVFNCLVSEIKT
LNLTYRKCDESLTFADVFPIYFDKSITELSSNIYNGVYLLAHALHQMLQTEAKDLSELPA
YSLLSWKLLHFLKCVNPVNGIKDELCGDGPSMTAERYDILNFRSFPGKIWTEVKVGEVIP
QEKVLSINEENIDWPEDFPQIPSSICSVACGPGFRKQFLEGRPICCFDCTLCPDGKISNK
TDAEQCMQCPEDQYPSKQKDRCLPKTVTYLAYEETLGMILASAALCFSILTTFVLGVFVM
HRDTPIVKANNCSLSYILLISLTLCFLSSLLFIGRPTPAICILRQTTFAIVFTVAIASIL
AKTITVVLAFRATKPGSQLRRWLRPAVSHSLIFICTLIQMGLCGIWLGTDPPFLEMDTHS
ESSFIVFQCNEGSLVTFFCVLGYMGFLALISFTLAFLARNLPDTFNEAKYLTFSMLVFCS
VWISFLLAYQSTKGKAMVAMEIFCILVSSAGILICIFAPKCYVILLKPGRNTLEILKNKA
Download sequence
Identical sequences F7C186
13616.ENSMODP00000025358 ENSMODP00000025358 ENSMODP00000025358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]